KEGG   Ursus arctos horribilis: 113242596
Entry
113242596         CDS       T05909                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04068  FoxO signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04660  T cell receptor signaling pathway
uah04672  Intestinal immune network for IgA production
uah05133  Pertussis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113242596 (IL10)
   04068 FoxO signaling pathway
    113242596 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113242596 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113242596 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113242596 (IL10)
   04660 T cell receptor signaling pathway
    113242596 (IL10)
   04672 Intestinal immune network for IgA production
    113242596 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113242596 (IL10)
   05322 Systemic lupus erythematosus
    113242596 (IL10)
   05320 Autoimmune thyroid disease
    113242596 (IL10)
   05321 Inflammatory bowel disease (IBD)
    113242596 (IL10)
   05330 Allograft rejection
    113242596 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113242596 (IL10)
   05133 Pertussis
    113242596 (IL10)
   05150 Staphylococcus aureus infection
    113242596 (IL10)
   05152 Tuberculosis
    113242596 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113242596 (IL10)
   05144 Malaria
    113242596 (IL10)
   05145 Toxoplasmosis
    113242596 (IL10)
   05140 Leishmaniasis
    113242596 (IL10)
   05142 Chagas disease (American trypanosomiasis)
    113242596 (IL10)
   05143 African trypanosomiasis
    113242596 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113242596 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113242596 (IL10)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113242596 (IL10)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113242596 (IL10)
SSDB
Motif
Pfam: IL10 IL22 ALIX_LYPXL_bnd CLZ
Other DBs
NCBI-GeneID: 113242596
NCBI-ProteinID: XP_026336515
UniProt: A0A3Q7U8C0
LinkDB
Position
Unknown
AA seq 178 aa
MPSPAQLCCLVLLAGVGASRHHTAPSEDNCTHFPASLPHMLRELRAAFGRVKTFFQMKDK
LDNILLTGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKAVEQVKSAFSKLQERGVYKAMSEFDIFINYIETYMTMRMKI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccagcccagcgcagctgtgttgcctggtcctgctggccggggtaggagccagccga
caccacactgccccgtctgaggacaactgcacccacttcccagccagcctgccccacatg
ctgcgagagctccgagctgccttcggcagggtgaagactttctttcaaatgaaggacaag
ctggacaacatattgttgacggggtccttgctggaggactttaagggttacctgggttgc
caagccttgtcggagatgatccagttttacttggaggaggtgatgccccaggctgagaac
cacgacccagacatcaaggagcacgtgaactccctgggggaaaagctgaagaccctgcgg
ctgaggctgcggcgctgtcatcgatttctgccctgcgagaataagagcaaggcggtggag
caggtgaagagcgcctttagtaagctccaagagagaggtgtctacaaagccatgagtgaa
tttgacatcttcatcaactacatagaaacctacatgacaatgaggatgaaaatctga

DBGET integrated database retrieval system