KEGG   Ursus arctos horribilis: 113242722
Entry
113242722         CDS       T05909                                 

Gene name
STK11
Definition
(RefSeq) serine/threonine-protein kinase STK11 isoform X1
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah04068  FoxO signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04211  Longevity regulating pathway
uah04530  Tight junction
uah04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113242722 (STK11)
   04151 PI3K-Akt signaling pathway
    113242722 (STK11)
   04152 AMPK signaling pathway
    113242722 (STK11)
   04150 mTOR signaling pathway
    113242722 (STK11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113242722 (STK11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    113242722 (STK11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113242722 (STK11)
  09149 Aging
   04211 Longevity regulating pathway
    113242722 (STK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113242722 (STK11)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113242722 (STK11)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   113242722 (STK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 113242722
NCBI-ProteinID: XP_026336668
UniProt: A0A3Q7UKK0
LinkDB
Position
Unknown
AA seq 566 aa
MDVADPQQMGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLVDGLEYLHSQGIVHKDIKPG
NLLLTTSGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGDYTIPGDCGPPLSDLLRGMLEYEPARRFSI
QQIRQHSWFRKKHPPAEELVPIPPSTDCKDRWRGMTVVPYLEDLHGCADDNGEEDLFDIE
DDIIYTQDFTVPGPRGGGWSERAEPGPTQSGVHEWHRVGPAEHQIKGGAPGQRGLQPHPQ
GLLSQQQDPPAVGLQAAMRAVTHSPSHGAPARRHGPGPQSSRRLLAHACCPGRPPPHPPC
RLPLGKPGVLEGRGWGTAGTGIWLSRCGQRTRPLVDFAALCRAPSPGPGRREHTGRRALW
EALAMHFMFRLLVLAPPLTSFYSAPR
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggatgtggccgacccgcagcagatgggcatgtttacagagggggagctgatgtccgtg
gggatggacacgttcatccaccgcatcgactccacggaagtcatctaccagccccggcgc
aagcgggccaagctcatcggcaagtacttgatgggagacctgctgggggaggggtcctac
ggcaaggtgaaggaggtgctggactcggagacgctgtgcaggagagctgtcaaaatcctc
aagaagaagaagttgcgaaggatccccaatggggaggcgaacgtcaagaaggaaatccaa
cttctgaggagattacggcacaaaaacgtcatccagctggtggacgtgttgtacaatgaa
gagaagcagaaaatgtatatggtgatggagtactgcgtgtgcggcatgcaggagatgctg
gacagtgtgccagagaagcgcttccccgtgtgccaggcccacgggtacttctgccagctg
gtggacggcctggagtacctgcacagccagggcatcgtgcacaaggacatcaagccgggc
aacctgctgctcaccaccagcggcacgctcaagatctccgacctgggtgtggctgaggcg
ctgcacccttttgctgaggacgacacgtgccgcacgagccagggctccccagcattccag
ccccctgagattgccaatggcctcgacaccttctctggctttaaggtggacatctggtca
gctggggtcactctctataacatcaccacaggcctgtacccgttcgagggggacaacatc
tacaagttgtttgagaacatcgggaagggagactacacgatcccgggtgactgcggcccc
ccgctctcggacttgctgagagggatgctggaatacgagccagccaggaggttctccata
cagcagatcagacaacacagctggttccggaagaagcacccgccagctgaggagctggta
cccatcccaccgagcacagactgcaaggatcgctggcgcggcatgacggtggtgccctac
ctggaggacctgcacggctgtgccgatgacaacggggaggaggacctgttcgatatcgag
gacgacatcatctatactcaggacttcacggtgcccggtcccagaggaggaggctggtca
gaacgggcagagccggggcccacccaaagtggtgtgcatgaatggcacagagtcggccca
gctgagcaccaaatcaaaggtggagcgccgggccagcgcggcctccaaccccacccgcaa
ggcctgctcagccagcagcaagatccgccggctgtcggcttgcaagcagcaatgagggca
gtcacccacagcccgtctcatggagccccagccaggcgccacggcccaggtcctcagtct
tcccgccgactgctggcccacgcctgctgcccaggaaggccaccaccacaccctccttgc
cgactgccccttgggaagccaggggtcctggagggccgtggctgggggacagcagggact
gggatctggctttcccgttgcggccagcggacacgacctcttgttgactttgcagccctg
tgccgagccccttcccctggcccagggaggagggagcacaccggcaggcgggccctgtgg
gaagcccttgccatgcactttatgttcagactactggttctcgccccacccctgacttct
ttttactctgctccacgttag

DBGET integrated database retrieval system