KEGG   Ursus arctos horribilis: 113242809
Entry
113242809         CDS       T05909                                 

Gene name
PIP5K1C
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 gamma isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
uah  Ursus arctos horribilis
Pathway
uah00562  Inositol phosphate metabolism
uah01100  Metabolic pathways
uah04070  Phosphatidylinositol signaling system
uah04072  Phospholipase D signaling pathway
uah04144  Endocytosis
uah04510  Focal adhesion
uah04666  Fc gamma R-mediated phagocytosis
uah04810  Regulation of actin cytoskeleton
uah05135  Yersinia infection
uah05231  Choline metabolism in cancer
Module
uah_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113242809 (PIP5K1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    113242809 (PIP5K1C)
   04072 Phospholipase D signaling pathway
    113242809 (PIP5K1C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113242809 (PIP5K1C)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113242809 (PIP5K1C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113242809 (PIP5K1C)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    113242809 (PIP5K1C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    113242809 (PIP5K1C)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113242809 (PIP5K1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113242809 (PIP5K1C)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     113242809 (PIP5K1C)
Membrane trafficking [BR:uah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    113242809 (PIP5K1C)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    113242809 (PIP5K1C)
 Endosome - Golgi transport
  Others
   Others
    113242809 (PIP5K1C)
SSDB
Motif
Pfam: PIP5K Hemopexin
Other DBs
NCBI-GeneID: 113242809
NCBI-ProteinID: XP_026336847
UniProt: A0A3Q7VG20
LinkDB
Position
Unknown
AA seq 707 aa
MELEVPDEAESAEAGAVTSEAAWAAESGAAAGLAQKKMVPTEAPLMTGQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
VLPRVVKMHLKFDLKGSTYKRRASKKEKEKSIPTYKDLDFIQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQQERERQAEGAQSTADEKRPLGQKALYSTAMES
IQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGALLAVKPLGPTAAFSASQIP
SEREDTQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPS
ETSEQPRYRRRTQSSGQDGRPQEETHVEEDLQQITVQVEPACSVEIVVPKEEDAGVEASP
AAAAAEAETTSQASEPASQASDEEDAPATDIYFFTDGRYWIYSPRHRRLRAVTLSSSGTV
SDHSRRPGSPAPVPPPWASGGPSSSEKGLGERIATTEAGHVSPSDVT
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggagctggaggtgccggacgaggcggagagcgccgaggcgggggccgtgacctcggag
gcggcctgggccgcggagagcggggcggcggcaggcttggcccagaagaagatggtcccg
acggaggccccgttgatgactggacagccgggtcctggccacgggaagaagttgggtcat
cggggcgtggacgcctctggcgagaccacctacaagaagaccacctcctccaccctgaag
ggggccatccagctgggcatcggctacactgtgggcaatctgagctctaagccagagcgc
gacgtgctcatgcaggacttctacgtcgtggagagcatcttcttccccagcgaaggcagc
aacctcacccctgcccaccacttccaggacttcaggttcaagacctacgcccccgtcgcc
ttccgctacttccgggagctcttcgggatccgaccggatgattacttgtactcgctgtgc
aacgagccgctgatcgagctgtccaaccccggcgccagcggctcactgttctacgtcacc
agcgacgatgagttcatcatcaagacggtgatgcacaaggaggccgagttcctgcagaag
ctgctgcccggctactacatgaacctcaaccagaacccgaggacgctgctgcccaagttc
tacgggctgtactgcgtgcagtcgggcggcaagaacatccgtgtggtggtcatgaacaac
gtcctgccgcgtgtcgtcaagatgcacctcaagttcgacctcaagggctccacgtacaag
cggcgggccagcaagaaggagaaggagaagagcatccccacctacaaggacctggacttc
atccaggacatgcccgaggggctcctactcgacgcagacaccttctccgcgctcgtcaag
acgctgcagcgggactgcctggtgctggagagcttcaagatcatggactacagcctgctg
ctgggcgtgcacaacatcgaccagcaggagcgcgagcggcaggccgagggtgcccagagc
accgcggacgaaaagcggccactcggccagaaggcgctctactccacggccatggagtcc
atccagggcggggcggcgcgcggggaggccatcgagtcggacgacacgatgggcgggatt
cccgctgtgaacggccgaggggagcgtctcttgctacatattggcatcattgacattctg
cagtcctacaggttcatcaagaaactggaacatacctggaaggctctcgtccacgacggg
gacaccgtctctgtccaccggcccagcttctatgcggagcgcttcttcaagttcatgagc
aacacggtcttccggaagaattcctccctgaaatcctcaccgtccaagaagggccgtggt
gccttgctggccgtcaagcccctggggcccacagctgccttctcggccagccagatcccc
agcgagcgggaggacacacagtacgacctccggggggcccgcagctaccccacgctggag
gacgaaggccggcccgacctcctgccctgcacgccgccgtcctttgaggaggccaccacc
gcctccatcgccacaaccctgtcctccacgtcgctctccatcccggagcgatctccctcg
gagacatcggagcagccgcggtaccggcggcgcacgcaatcttcgggacaggatggccgg
ccccaggaggagacacacgtggaggaggacctgcagcagatcacggtgcaggtggagccc
gcgtgcagcgtggagatcgtggtccccaaggaggaggatgcaggggtggaggcttcccca
gctgctgccgctgccgaagcagaaaccaccagccaggcctcggagcccgccagccaggcc
tcggatgaggaggacgcccccgccacggacatctactttttcaccgatgggaggtactgg
atttactctccccggcatcgccgactgcgggccgtgacgctgagctcctcagggactgta
agtgaccacagcaggcgtccagggagcccagcccccgttccaccaccctgggcatcaggc
ggtccctcgtcctctgagaagggacttggggaaagaatcgccaccactgaggccggtcat
gtgtcccccagtgacgtcacttag

KEGG   Ursus arctos horribilis: 113246140
Entry
113246140         CDS       T05909                                 

Gene name
PIP5K1A
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 alpha isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
uah  Ursus arctos horribilis
Pathway
uah00562  Inositol phosphate metabolism
uah01100  Metabolic pathways
uah04070  Phosphatidylinositol signaling system
uah04072  Phospholipase D signaling pathway
uah04144  Endocytosis
uah04510  Focal adhesion
uah04666  Fc gamma R-mediated phagocytosis
uah04810  Regulation of actin cytoskeleton
uah05135  Yersinia infection
uah05231  Choline metabolism in cancer
Module
uah_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113246140 (PIP5K1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    113246140 (PIP5K1A)
   04072 Phospholipase D signaling pathway
    113246140 (PIP5K1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113246140 (PIP5K1A)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113246140 (PIP5K1A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113246140 (PIP5K1A)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    113246140 (PIP5K1A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    113246140 (PIP5K1A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113246140 (PIP5K1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113246140 (PIP5K1A)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     113246140 (PIP5K1A)
Membrane trafficking [BR:uah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    113246140 (PIP5K1A)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    113246140 (PIP5K1A)
 Endosome - Golgi transport
  Others
   Others
    113246140 (PIP5K1A)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 113246140
NCBI-ProteinID: XP_026342412
UniProt: A0A3Q7VWY1
LinkDB
Position
Unknown
AA seq 560 aa
MASASSGPSAAGVSSLDPAVPSCASSSASGIKRSMASEVPYASGMPIKKIGHRGVDSSGE
TTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHY
NDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCNSGASGSLFYVSSDDEFIIK
TVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKM
HIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLV
LQSFKIMDYSLLMSIHNIDHAQREPLGSEAQSSADTRRPAPQKALYSTAMESIQGEARRG
GTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRP
GFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGPSGNSCITYQTSVSGEHKAQ
VTTKAEVEPGVHFGRPDVLPQTPPLEKISEVSTLPDPYFSPVVGETLQMQTTSEQKNSED
LEQDSTSLVIPRSQPLPQQC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggcgtcggcctcctctgggccgtcagcggccggggtttcatccttggatcccgcggtc
ccttcctgcgcctcgtcctcagcatcaggaatcaagagatccatggcatctgaggtgcct
tatgcctctggcatgcccatcaagaaaataggccaccgaggtgttgattcctcaggagag
acgacatataaaaagacaacctcatctgccttgaaaggtgccatccagttaggcattact
cacactgtgggaagcctgagtaccaaaccagagcgtgatgtcctcatgcaagacttctat
gtggtggagagtatcttcttccccagcgaagggagcaacttgacccctgctcatcactac
aatgactttcggttcaagacctatgcacctgttgcctttcgttactttcgggagttattt
ggtatccggcctgatgattacttgtactccctctgcagtgagccgctgattgagctctgc
aactctggagctagtggttccctcttctacgtgtccagtgacgatgaattcatcattaaa
acggtccagcataaagaggcggagtttctgcagaagctgcttccaggatactacatgaac
ctcaaccagaatcctcgcactttgctgcctaaattctatggactgtactgtgtgcaggca
ggtggtaagaacattcgaattgtggtgatgaacaatctcttaccacggtcggtcaagatg
cacatcaaatatgacctcaagggctcgacctacaaacgccgggcttcccaaaaagagcga
gagaagcctctccccacctttaaagacctggacttcttacaagacattccagatggtctt
tttctggatgctgatatgtacaatgctctgtgtaagaccctacagcgtgactgtctggtg
ctgcagagcttcaagataatggactatagcctcttgatgtcgatccataacatagatcat
gcacaacgagagcccttaggcagtgaagcacaatcctcagctgacactcgcagaccagcc
ccccaaaaggctctctattccacggctatggaatctatccagggcgaggctcggcgaggt
ggcaccatggagactgatgaccatatgggtggcatccctgcccgcaatagtaaaggggag
aggctgctgctttatattgggatcatcgacatcctccagtcttacaggtttgttaagaag
ttggagcactcttggaaagcgctggtacacgatggggacaccgtatcggtgcatcgccca
ggcttctatgctgaacggttccagcgcttcatgtgcaacaccgtgttcaagaagataccc
ctgaagccctctccttccaaaaagtttcggtctggctcatctttctctcggcgagcaggc
cccagcggcaactcctgcattacttaccagacatcggtctctggggagcacaaggcacaa
gtgacaaccaaggcggaagtggagccaggcgtccacttcggtcgtcctgatgttttacct
cagactccacctttggagaaaatcagtgaggtctcgactcttcctgacccctatttctca
cctgtagttggagagactttgcaaatgcaaactacaagtgagcaaaaaaactcagaagac
ctggaacaagattctaccagcttggtgatcccaaggagccagcccttgccccagcaatgc
tga

KEGG   Ursus arctos horribilis: 113270193
Entry
113270193         CDS       T05909                                 

Gene name
PIP5K1B
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 beta isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
uah  Ursus arctos horribilis
Pathway
uah00562  Inositol phosphate metabolism
uah01100  Metabolic pathways
uah04070  Phosphatidylinositol signaling system
uah04072  Phospholipase D signaling pathway
uah04144  Endocytosis
uah04510  Focal adhesion
uah04666  Fc gamma R-mediated phagocytosis
uah04810  Regulation of actin cytoskeleton
uah05135  Yersinia infection
uah05231  Choline metabolism in cancer
Module
uah_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113270193 (PIP5K1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    113270193 (PIP5K1B)
   04072 Phospholipase D signaling pathway
    113270193 (PIP5K1B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113270193 (PIP5K1B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113270193 (PIP5K1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113270193 (PIP5K1B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    113270193 (PIP5K1B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    113270193 (PIP5K1B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113270193 (PIP5K1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113270193 (PIP5K1B)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     113270193 (PIP5K1B)
Membrane trafficking [BR:uah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    113270193 (PIP5K1B)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    113270193 (PIP5K1B)
 Endosome - Golgi transport
  Others
   Others
    113270193 (PIP5K1B)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 113270193
NCBI-ProteinID: XP_026375106
UniProt: A0A3Q7XC59
LinkDB
Position
Unknown
AA seq 548 aa
MTCHFIYKMSSAAENGDATPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPDRDV
LMQDFYVVESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSE
PLIELSNPGASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYG
LYCMQSGGINIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQ
DMHEGLYFDTETYNALIKTLQRDCRVLESFKIMDYSLLLGIHILDHSLKEKEEDSSQNVP
DAKRSGMQKVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHKGEKLLLFMGIIDIL
QSYRLMKKLEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCN
SIAALKATSQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEA
ASLATTISSSSLYVDEHCPHDRTALYSNSKGLPSSSTYTLEEGTIYLTSEPNALEMQDDN
ASVLDVYL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgacttgccatttcatttacaagatgtcgtctgctgctgaaaatggagatgccacacct
ggaaaacagaatgaagaaaaaacttataaaaagactgcatcatctgctatcaaaggtgct
attcagctgggaataggatacacagtggggaatctcacttccaagccagatagagatgtc
ctcatgcaagacttttatgtagtggaaagcgtgttcctgcccagcgaagggagcaatctg
accccagcacatcattacccagacttcagatttaagacgtacgctccgctagcattccga
tatttcagagaactttttggtatcaagcctgatgattacttgtattccatctgcagcgaa
cctctaatagagctgtccaaccctggagccagtggatccttgttttttgtgaccagtgat
gatgaatttatcatcaaaaccgttcagcataaagaagctgaattccttcagaagttactg
ccaggctattacatgaatctaaatcagaatccaaggactcttttgccaaaattttatgga
ctgtattgcatgcaatccgggggcattaatatcaggattgtggtaatgaacaacgtctta
ccgcgctccatgagaatgcacttcacgtatgacctgaaaggctccacttacaagcgaaga
gcctcccgaaaggagagagagaaatccaaccccacatttaaggacttagatttcctgcaa
gacatgcacgaagggttatattttgacacagaaacctacaacgcgctcataaaaacactt
cagagagactgccgggtgctggaaagcttcaaaatcatggactacagccttttgctggga
atccacatcttggaccattccctcaaagagaaagaggaggacagctcacaaaatgtgcct
gacgctaagaggtctgggatgcagaaggtcctctattccacagcaatggaatccatccag
ggtccggggaaatctggagatggaatcatcacagagaacccggacacaatgggaggcatt
ccagctaaaagccataagggagaaaaactacttttatttatgggcattattgacattttg
caatcatataggttaatgaagaagctagaacattcctggaaagctcttgtttatgatggg
gataccgtttcagttcatcgaccaagcttttatgctgacagatttctgaagtttatgaat
tccagagttttcaagaaaattcaagccttgaaggcctcgccttctaaaaaacgttgcaac
tccatcgctgccctgaaggcaacctcgcaagagatcgtgtcctcaattagccaggagtgg
aaggacgagaagcgtgacttgctgactgaagggcagagtttcagcagccttgacgaagaa
gcactgggatcccgacacaggccggacctggtgcctagcaccccgtcactgtttgaagct
gcttccttggcaaccactatttcgtcttcttccttatatgtcgatgaacattgtccgcac
gacaggactgcgctctattcaaacagtaaagggttaccttccagttccacatacaccttg
gaagaggggaccatctacctgacttctgagccaaacgctctggaaatgcaggatgataat
gcctccgtgcttgatgtctatttataa

DBGET integrated database retrieval system