KEGG   Ursus arctos horribilis: 113242885
Entry
113242885         CDS       T05909                                 

Gene name
TNFSF14
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 14
  KO
K05477  tumor necrosis factor ligand superfamily member 14
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04064  NF-kappa B signaling pathway
uah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113242885 (TNFSF14)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113242885 (TNFSF14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113242885 (TNFSF14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113242885 (TNFSF14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113242885 (TNFSF14)
   04090 CD molecules [BR:uah04090]
    113242885 (TNFSF14)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Tumor necrosis fators
   113242885 (TNFSF14)
CD molecules [BR:uah04090]
 Proteins
  113242885 (TNFSF14)
SSDB
Motif
Pfam: TNF UreE_N
Other DBs
NCBI-GeneID: 113242885
NCBI-ProteinID: XP_026336998
UniProt: A0A3Q7ULG6
LinkDB
Position
Unknown
AA seq 241 aa
MEETVVRPSVFTVDGQTDIPFTRLGRRRRRQPCTAAQLGLGLLLLLLAAGLAVQGWFLLQ
LHWRLGAMVTPLLDGDAESWKQLTQERRSHQANPAAHLTGANSSLTGSGGPLLWETKLGL
AFLRGLSYREGSLVIARAGYYYIYSKVQLGGVGCPQGLSGGLPITHGLYKRTPRYPEELE
LLVSRRSPCGRATNPRVWWDSSFLGGVVHLDAGEEVVVRVPDERLVRLRDGTRSYFGAFM
V
NT seq 726 nt   +upstreamnt  +downstreamnt
atggaggagacagttgtgcgaccttcggtgttcacagtggacggacagacagacatccca
ttcacgaggctggggcgcaggcgccggaggcagccgtgcactgcggcccagctgggcctg
ggcctcctgttgctgctgctggcggctgggctggccgttcagggctggttcctgcttcag
ctgcactggcgcctgggggcgatggtcacacccctgctggacggagatgcagaatcctgg
aagcagctgacccaagagcggaggtcccaccaggccaacccagccgcacaccttacagga
gccaactccagcctgacgggcagcgggggcccgctgctctgggagacgaagctgggcttg
gccttcctgcggggcctcagctaccgcgagggctccctggtgatcgcgcgggccggctac
tactacatctactccaaggtgcagctgggaggcgtgggctgcccgcaggggctcagcggc
ggcctgcccatcacgcacggcctctacaagcgcacgccccgctaccccgaggagctggag
ctgctggtcagccggcgctcaccctgcgggcgggcaaccaacccccgcgtctggtgggac
agcagcttcctggggggcgtggtgcacctggacgcaggcgaagaggtggtggtccgggtg
cccgacgagcgcctggtccgactccgcgatggcacccgctcctacttcggggctttcatg
gtgtga

DBGET integrated database retrieval system