KEGG   Ursus arctos horribilis: 113242985
Entry
113242985         CDS       T05909                                 

Gene name
TYK2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
uah  Ursus arctos horribilis
Pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04621  NOD-like receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05145  Toxoplasmosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113242985 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113242985 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113242985 (TYK2)
   04658 Th1 and Th2 cell differentiation
    113242985 (TYK2)
   04659 Th17 cell differentiation
    113242985 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113242985 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    113242985 (TYK2)
   05164 Influenza A
    113242985 (TYK2)
   05161 Hepatitis B
    113242985 (TYK2)
   05160 Hepatitis C
    113242985 (TYK2)
   05168 Herpes simplex virus 1 infection
    113242985 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113242985 (TYK2)
   05169 Epstein-Barr virus infection
    113242985 (TYK2)
   05165 Human papillomavirus infection
    113242985 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113242985 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113242985 (TYK2)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     113242985 (TYK2)
Protein kinases [BR:uah01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   113242985 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kinase-like Kdo
Other DBs
NCBI-GeneID: 113242985
NCBI-ProteinID: XP_026337159
UniProt: A0A3Q7UA82
LinkDB
Position
Unknown
AA seq 1182 aa
MPLCHWGATTRDSRPDGDGTQPMATRGGLKVLLHWAGPGGGDPWVTFSEATLTAEEVCIH
IAQKVGITPSCLNLFALFDAQAQVWLPPNHVLEISRDMSLTLYFRMRFYFRNWHGTNPQE
PAVYRCGPPGAKSSSEQAEQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHF
KNESLGMAFLHLCHLALCHGVPLEKVAKKISFKDCIPRSFRLQIRRHNALTRLRLRNIFR
RFVRAFQPGHVSQQVIMVKYLATLEQLAPRFGTERVPVCRLQLPAQAGGEPYYIRDGGQP
PPDPGPELAPGPPTHEVLVTGTGGIQWRPVQAEGPRGDGSSRNPHAGPSGKKTKAPEVVD
QPADRPREAPWAYFCDFRDITHVVLKERHVSIHCQDNKSLELTLPSRAAALSLVSLVDGY
FRLTADSSHYLCHEVAPPRLVMSIQEGIHGPLLEPFVLAKLRPEDGLYLVHWSASHLNRL
ILTVAQREQAPGTQHVHLRKFPIELQAGVFTLEGWDRSFPSVRELRAALQGCSLRAGDDC
FSLRRCCLPRPGEISNLIVMRGPRASTGPPNLSQLSFHRVCRDDITQLSHLGQGTRTNVY
EGILRVGGRSPEEGMADGEDPPTPSGDRGQELRVVLKVLDPSHHDIALAFYETASLMSQV
SHVHLAFVHGICVHGSENIMVTEYVEHGPLDVWLRREKGHTPVAWKVVVAQQLASALSYL
EDKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERAERIPWIAPECLS
GGANSLTTAADQWGFGATLLEICFDGEAPLQGRGPSEKECFYQKQHQLPQPSCPELATLT
SQCLTYEPAQRPSFRTILRDLTQLQPQNLADVLAVNPDSPASDPTVFHKRYLKKIRDLGE
GHFGKVSLYCYDPTNDGTGEMVAVKALKADCSPQLRTGWRREIDILRTLYHKHIVKYRGC
CEDPGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHGQHYVHRDLA
ARNVLLDNDRLVKLGDFGLTKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVW
SFGVTLYELLTYCDSSQSPPSKFIELIGLTQGQMTVLRLTELLERGERLPRPERCPCEIY
LLMKNCWEAEASFRPTFQNLIPILKTAQEKYQGQAASVFNVC
NT seq 3549 nt   +upstreamnt  +downstreamnt
atgcctctgtgccattggggtgccaccaccagggacagcaggcctgatggcgatggaact
cagcccatggccaccaggggaggcctgaaggttcttctgcactgggctggccctggtggc
ggggacccatgggtcaccttcagcgaagccacactgaccgcagaggaggtctgcatccac
attgcacaaaaagttggtatcactccatcctgcctcaatctctttgctctcttcgatgcc
caggctcaggtctggctgcccccaaaccatgtcttggagatctccagagacatgagcctg
acattgtatttccgcatgaggttttatttccggaactggcatggcacaaaccctcaggaa
ccggctgtgtaccgctgtgggcccccaggggccaagtcttcctcagaacaggcagagcag
gggatgcaattgctggacccagcgtcctttgagtacctctttgagcagggcaagcatgag
tttgtgaatgacgtggcgtcactgtgggagctgtcgagcgaggaggagatccaccatttt
aagaacgagagtctgggcatggcctttctgcacctctgccacctggctctctgccatggc
gtccccctggagaaggtggccaagaagatcagcttcaaggactgcatcccgcgctccttc
cggctgcagatccggcggcacaacgcgctgacgaggctacgcttgcggaacatcttccgc
aggttcgtgcgggccttccagccgggccacgtctcgcagcaggtcatcatggtcaagtac
ctggccacgctcgagcagctggcaccccgcttcggcacggagcgcgtgcccgtgtgccgc
ctgcagctaccggcccaggccggtggggagccctactacatccgggacggcgggcagcct
cccccagatcctgggccggagttggcccccggaccccccactcatgaggtgctggtgacg
ggcacgggtggcatccagtggcggccggtacaggcagagggtcccagaggcgatggcagc
agcaggaatccccatgctggcccatctgggaagaaaaccaaggccccagaggtggtcgac
cagccagcagacaggcctcgggaagcgccatgggcctacttctgtgacttccgggatatc
acgcacgtggtgctgaaagaacgccacgtcagcatccactgtcaggacaacaagagcctg
gagctgaccctgccttcccgggccgcggccctgtccttggtgtcgctggtggacggctat
ttccgccttaccgccgactcgagccactacctgtgccacgaggtggctcctccacggctg
gtgatgagcatccaggagggtatccacggacccctgctggagccgtttgtgctggccaag
ctgcggccggaggatggcctctacctcgtccactggagcgccagccacctcaaccgcctc
atcctgaccgtggcccagcgtgagcaggcaccgggcacacagcacgtgcacctgcgtaaa
ttccccattgagctgcaggcgggggtcttcacgctggagggctgggaccggtccttcccc
agcgtgcgcgagctgcgagctgccctgcagggttgctccctgcgggctggcgatgactgt
ttctccctgcgccgctgctgcctgccgcggccgggagagatctccaacctcatcgtcatg
cgggggcctcgggccagcacgggcccccccaacctcagccagctcagcttccaccgggtc
tgccgggatgacatcacccagctctcccacttgggccaaggcacaaggaccaatgtgtat
gagggcatcttacgagtggggggcagaagccccgaggagggcatggcagatggtgaggac
ccccccacgcccagtggggaccgtgggcaagagctccgagtggtactcaaggtgctggac
cccagtcaccatgacatcgccctggccttctacgagacagccagcctcatgagccaggtg
tcccacgtgcacctggccttcgtgcacggcatctgcgtgcacggctctgagaacatcatg
gtgacggagtacgtggagcacgggcccctggatgtgtggctgcggcgagagaagggccac
acgcctgtggcctggaaggtggtggtggcccagcagctggccagcgccctcagctacctg
gaagacaagaacctggttcatggtaatgtgtgtggccggaacattctgctggcacgactg
gggctggcggagggcaccagccccttcatcaagctgagcgaccccggtgtgggcctgggc
gccctttccagggaggagcgggcggagcggatcccctggatagcccccgagtgtctctct
ggtggggccaacagcctaaccaccgcagccgatcaatggggctttggtgctaccctcctg
gagatctgcttcgacggggaggcccctctgcagggccgtggcccctctgagaaagagtgt
ttctaccagaagcagcaccagcttcctcagccctcctgcccagagctggccacactcacc
agccagtgcctgacctatgaaccagctcagcggccctccttccgcaccatcctgcgtgac
ctcactcaactgcagccccagaatcttgctgacgtcttggctgtgaaccccgactcgcct
gcgtcagaccccaccgttttccacaagcgctatttgaaaaagatccgggatctgggcgag
ggtcatttcggcaaggtcagcctgtactgctacgaccccacgaacgacggcactggggag
atggtggccgtgaaggccctcaaggcggactgcagcccccagctgcgcaccggctggagg
cgggagatcgacatcctgcgcacgctctaccacaagcacatcgtcaagtacaggggctgc
tgcgaggacccaggagagaagtcggtgcagctcgtcatggagtacgtgcctctgggaagc
ctgcgcgactacctgccgcggcacagcgtcggactcgcgcagctgctgctcttcgctcag
cagatctgtgagggcatggcctaccttcacggacagcactacgtgcaccgagacctggct
gcccgcaacgtgctgctggacaacgacaggctggtcaaacttggggactttggcctgacc
aaggctgtgcctgagggccatgaatactaccgcgtgcgcgaggacggggacagccccgta
ttctggtatgccccagagtgcctgaaggagtgtaagttctactatgcgtccgacgtctgg
tccttcggggtcaccctctacgagctgctgacctactgtgactccagccagagccccccc
tcgaaattcatcgagctcataggcctcacccaggggcagatgacggtgctgaggctcact
gagctgctggaacgaggggagaggctgccccggccagagagatgtccttgtgagatctat
ctcctcatgaagaactgctgggaggcagaggcttcattccgtcccaccttccagaacctc
atacccattctcaagaccgcccaggagaaataccaaggccaggccgcctcagtgttcaat
gtgtgctga

DBGET integrated database retrieval system