KEGG   Ursus arctos horribilis: 113243106
Entry
113243106         CDS       T05909                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04024  cAMP signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04137  Mitophagy - animal
uah04140  Autophagy - animal
uah04141  Protein processing in endoplasmic reticulum
uah04210  Apoptosis
uah04215  Apoptosis - multiple species
uah04217  Necroptosis
uah04310  Wnt signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04530  Tight junction
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04723  Retrograde endocannabinoid signaling
uah04728  Dopaminergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04910  Insulin signaling pathway
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04917  Prolactin signaling pathway
uah04920  Adipocytokine signaling pathway
uah04926  Relaxin signaling pathway
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05010  Alzheimer disease
uah05012  Parkinson disease
uah05016  Huntington disease
uah05017  Spinocerebellar ataxia
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05210  Colorectal cancer
uah05212  Pancreatic cancer
uah05231  Choline metabolism in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113243106 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113243106 (MAPK8)
   04010 MAPK signaling pathway
    113243106 (MAPK8)
   04012 ErbB signaling pathway
    113243106 (MAPK8)
   04310 Wnt signaling pathway
    113243106 (MAPK8)
   04668 TNF signaling pathway
    113243106 (MAPK8)
   04068 FoxO signaling pathway
    113243106 (MAPK8)
   04071 Sphingolipid signaling pathway
    113243106 (MAPK8)
   04024 cAMP signaling pathway
    113243106 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113243106 (MAPK8)
   04137 Mitophagy - animal
    113243106 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    113243106 (MAPK8)
   04215 Apoptosis - multiple species
    113243106 (MAPK8)
   04217 Necroptosis
    113243106 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113243106 (MAPK8)
   04530 Tight junction
    113243106 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113243106 (MAPK8)
   04621 NOD-like receptor signaling pathway
    113243106 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    113243106 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    113243106 (MAPK8)
   04660 T cell receptor signaling pathway
    113243106 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    113243106 (MAPK8)
   04659 Th17 cell differentiation
    113243106 (MAPK8)
   04657 IL-17 signaling pathway
    113243106 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    113243106 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113243106 (MAPK8)
   04920 Adipocytokine signaling pathway
    113243106 (MAPK8)
   04912 GnRH signaling pathway
    113243106 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    113243106 (MAPK8)
   04917 Prolactin signaling pathway
    113243106 (MAPK8)
   04926 Relaxin signaling pathway
    113243106 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    113243106 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    113243106 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    113243106 (MAPK8)
   04722 Neurotrophin signaling pathway
    113243106 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113243106 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113243106 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243106 (MAPK8)
   05231 Choline metabolism in cancer
    113243106 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113243106 (MAPK8)
   05212 Pancreatic cancer
    113243106 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113243106 (MAPK8)
   05012 Parkinson disease
    113243106 (MAPK8)
   05016 Huntington disease
    113243106 (MAPK8)
   05017 Spinocerebellar ataxia
    113243106 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113243106 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113243106 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113243106 (MAPK8)
   04931 Insulin resistance
    113243106 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113243106 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113243106 (MAPK8)
   05135 Yersinia infection
    113243106 (MAPK8)
   05133 Pertussis
    113243106 (MAPK8)
   05152 Tuberculosis
    113243106 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243106 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    113243106 (MAPK8)
   05162 Measles
    113243106 (MAPK8)
   05161 Hepatitis B
    113243106 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243106 (MAPK8)
   05169 Epstein-Barr virus infection
    113243106 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243106 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    113243106 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113243106 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113243106 (MAPK8)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113243106 (MAPK8)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113243106 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 113243106
NCBI-ProteinID: XP_026337313
UniProt: A0A3Q7UMF3
LinkDB
Position
Unknown
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctaccttt
acagtcttgaaacggtatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcagactcatgctaaacgggcttacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtggtaaaa
tcagactgcactttgaagattcttgactttggactggccaggaccgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgccctgaattcatgaagaaactacagccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccccgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaattgatgcatctaaaaggatctctgtagatgaagctctccagcacccgtat
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgataag
cagttagatgaaagggaacatacaatagaagaatggaaagagttgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtccgtcaatgatgtgtct
tcaatgtcaacagatccaactttggcctcagatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

KEGG   Ursus arctos horribilis: 113261548
Entry
113261548         CDS       T05909                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04024  cAMP signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04137  Mitophagy - animal
uah04140  Autophagy - animal
uah04141  Protein processing in endoplasmic reticulum
uah04210  Apoptosis
uah04215  Apoptosis - multiple species
uah04217  Necroptosis
uah04310  Wnt signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04530  Tight junction
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04723  Retrograde endocannabinoid signaling
uah04728  Dopaminergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04910  Insulin signaling pathway
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04917  Prolactin signaling pathway
uah04920  Adipocytokine signaling pathway
uah04926  Relaxin signaling pathway
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05010  Alzheimer disease
uah05012  Parkinson disease
uah05016  Huntington disease
uah05017  Spinocerebellar ataxia
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05210  Colorectal cancer
uah05212  Pancreatic cancer
uah05231  Choline metabolism in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113261548 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113261548 (MAPK9)
   04010 MAPK signaling pathway
    113261548 (MAPK9)
   04012 ErbB signaling pathway
    113261548 (MAPK9)
   04310 Wnt signaling pathway
    113261548 (MAPK9)
   04668 TNF signaling pathway
    113261548 (MAPK9)
   04068 FoxO signaling pathway
    113261548 (MAPK9)
   04071 Sphingolipid signaling pathway
    113261548 (MAPK9)
   04024 cAMP signaling pathway
    113261548 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113261548 (MAPK9)
   04137 Mitophagy - animal
    113261548 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    113261548 (MAPK9)
   04215 Apoptosis - multiple species
    113261548 (MAPK9)
   04217 Necroptosis
    113261548 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113261548 (MAPK9)
   04530 Tight junction
    113261548 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113261548 (MAPK9)
   04621 NOD-like receptor signaling pathway
    113261548 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    113261548 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    113261548 (MAPK9)
   04660 T cell receptor signaling pathway
    113261548 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    113261548 (MAPK9)
   04659 Th17 cell differentiation
    113261548 (MAPK9)
   04657 IL-17 signaling pathway
    113261548 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    113261548 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113261548 (MAPK9)
   04920 Adipocytokine signaling pathway
    113261548 (MAPK9)
   04912 GnRH signaling pathway
    113261548 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    113261548 (MAPK9)
   04917 Prolactin signaling pathway
    113261548 (MAPK9)
   04926 Relaxin signaling pathway
    113261548 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    113261548 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    113261548 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    113261548 (MAPK9)
   04722 Neurotrophin signaling pathway
    113261548 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113261548 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113261548 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261548 (MAPK9)
   05231 Choline metabolism in cancer
    113261548 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113261548 (MAPK9)
   05212 Pancreatic cancer
    113261548 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113261548 (MAPK9)
   05012 Parkinson disease
    113261548 (MAPK9)
   05016 Huntington disease
    113261548 (MAPK9)
   05017 Spinocerebellar ataxia
    113261548 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113261548 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113261548 (MAPK9)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113261548 (MAPK9)
   04931 Insulin resistance
    113261548 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113261548 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113261548 (MAPK9)
   05135 Yersinia infection
    113261548 (MAPK9)
   05133 Pertussis
    113261548 (MAPK9)
   05152 Tuberculosis
    113261548 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113261548 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    113261548 (MAPK9)
   05162 Measles
    113261548 (MAPK9)
   05161 Hepatitis B
    113261548 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113261548 (MAPK9)
   05169 Epstein-Barr virus infection
    113261548 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113261548 (MAPK9)
   05142 Chagas disease (American trypanosomiasis)
    113261548 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113261548 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113261548 (MAPK9)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113261548 (MAPK9)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113261548 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 113261548
NCBI-ProteinID: XP_026363490
UniProt: A0A3Q7WEW4
LinkDB
Position
Unknown
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
LDWEERSKNGVVKDQPSDAAVSSNATPSRSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtacaagtggcagactcaaccttc
acggtcctcaaacgttaccagcagttgaagccaatcggctccggagcccaaggaatagtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaactcatgcaaagagagcttaccgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttattaaatgtgtttacaccacaaaagactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagttggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catctgcattcagctggtatcattcatagagacttgaaaccgagcaacatcgtggtaaaa
tcagactgcacgcttaagatccttgactttggcctggcccggacagcatgcaccaacttc
atgatgacgccgtacgtggtgacgcgctattaccgggcgcccgaagtcatcctcggcatg
ggctacaaggagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgattttccaaggcactgatcatattgatcagtggaataaagtcattgagcag
ctgggaacaccgtccgcggattttatgaagaaacttcagccgaccgtgaggaattatgta
gaaaacagaccgaagtaccccggcatcaaatttgaagagctcttccccgattggatattc
ccatcagaatccgagcgagacaaaattaaaacaagtcaagccagagatttgttatcgaaa
atgttagtgatagatcccgacaagcgaatctctgtagacgaagctttacgtcacccttat
attaccgtttggtatgaccctgctgaagccgaggcgccaccacctcagatttacgatgcc
cagctggaagaaagagagcatgcaattgaagagtggaaagagctgatttacaaagaagtg
ctggattgggaagaacgaagcaagaacggtgtggtcaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttcccggtcgtcgtccatcaacgacatctcgtccatgtcc
actgagcagacgctggcctcagacacagacagcagcctcgacgcctcgacgggacccctc
gaaggttgccgatga

KEGG   Ursus arctos horribilis: 113263180
Entry
113263180         CDS       T05909                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04024  cAMP signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04137  Mitophagy - animal
uah04140  Autophagy - animal
uah04141  Protein processing in endoplasmic reticulum
uah04210  Apoptosis
uah04215  Apoptosis - multiple species
uah04217  Necroptosis
uah04310  Wnt signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04530  Tight junction
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04723  Retrograde endocannabinoid signaling
uah04728  Dopaminergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04910  Insulin signaling pathway
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04917  Prolactin signaling pathway
uah04920  Adipocytokine signaling pathway
uah04926  Relaxin signaling pathway
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05010  Alzheimer disease
uah05012  Parkinson disease
uah05016  Huntington disease
uah05017  Spinocerebellar ataxia
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05210  Colorectal cancer
uah05212  Pancreatic cancer
uah05231  Choline metabolism in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113263180 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113263180 (MAPK10)
   04010 MAPK signaling pathway
    113263180 (MAPK10)
   04012 ErbB signaling pathway
    113263180 (MAPK10)
   04310 Wnt signaling pathway
    113263180 (MAPK10)
   04668 TNF signaling pathway
    113263180 (MAPK10)
   04068 FoxO signaling pathway
    113263180 (MAPK10)
   04071 Sphingolipid signaling pathway
    113263180 (MAPK10)
   04024 cAMP signaling pathway
    113263180 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113263180 (MAPK10)
   04137 Mitophagy - animal
    113263180 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    113263180 (MAPK10)
   04215 Apoptosis - multiple species
    113263180 (MAPK10)
   04217 Necroptosis
    113263180 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113263180 (MAPK10)
   04530 Tight junction
    113263180 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113263180 (MAPK10)
   04621 NOD-like receptor signaling pathway
    113263180 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    113263180 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    113263180 (MAPK10)
   04660 T cell receptor signaling pathway
    113263180 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    113263180 (MAPK10)
   04659 Th17 cell differentiation
    113263180 (MAPK10)
   04657 IL-17 signaling pathway
    113263180 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    113263180 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113263180 (MAPK10)
   04920 Adipocytokine signaling pathway
    113263180 (MAPK10)
   04912 GnRH signaling pathway
    113263180 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    113263180 (MAPK10)
   04917 Prolactin signaling pathway
    113263180 (MAPK10)
   04926 Relaxin signaling pathway
    113263180 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    113263180 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    113263180 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    113263180 (MAPK10)
   04722 Neurotrophin signaling pathway
    113263180 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113263180 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113263180 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113263180 (MAPK10)
   05231 Choline metabolism in cancer
    113263180 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113263180 (MAPK10)
   05212 Pancreatic cancer
    113263180 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113263180 (MAPK10)
   05012 Parkinson disease
    113263180 (MAPK10)
   05016 Huntington disease
    113263180 (MAPK10)
   05017 Spinocerebellar ataxia
    113263180 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113263180 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113263180 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113263180 (MAPK10)
   04931 Insulin resistance
    113263180 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113263180 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113263180 (MAPK10)
   05135 Yersinia infection
    113263180 (MAPK10)
   05133 Pertussis
    113263180 (MAPK10)
   05152 Tuberculosis
    113263180 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113263180 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    113263180 (MAPK10)
   05162 Measles
    113263180 (MAPK10)
   05161 Hepatitis B
    113263180 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113263180 (MAPK10)
   05169 Epstein-Barr virus infection
    113263180 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113263180 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    113263180 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113263180 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113263180 (MAPK10)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113263180 (MAPK10)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113263180 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 113263180
NCBI-ProteinID: XP_026365578
UniProt: A0A3Q7WUV0
LinkDB
Position
Unknown
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVEDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacggtt
ctcaagcgctaccagaatctgaagcctattggctctggggctcagggaatagtttgtgct
gcgtacgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacacatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacactggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggaa
ttagaccacgagcgaatgtcttacctgctgtaccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgtacgttgaaaatcctcgactttggactggccaggacggcaggcacaagcttcatgatg
actccttatgtggttacacgttattatagagcccccgaggttattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgaacaactagga
acaccatgtccggaattcatgaagaaattgcaacctacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttactgtcaaagatgcta
gtgattgaccccgcaaagaggatatcagtggaggacgccttgcagcacccttacatcaat
gtgtggtacgaccctgccgaagtggaagcgcctccacctcagatttatgacaaacagttg
gatgaaagagaacacaccattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcggaagaaaagactaaaaacggtgttgtaaaaggacaaccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccgtcttcgtccgtcaacgacatctcctccatgtcc
accgaccagaccctggcatccgacactgacagcagcctggaagcctcagcaggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system