KEGG   Ursus arctos horribilis: 113243505
Entry
113243505         CDS       T05909                                 

Gene name
ARHGEF1
Definition
(RefSeq) rho guanine nucleotide exchange factor 1 isoform X1
  KO
K12330  Rho guanine nucleotide exchange factor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04270  Vascular smooth muscle contraction
uah04611  Platelet activation
uah04810  Regulation of actin cytoskeleton
uah04928  Parathyroid hormone synthesis, secretion and action
uah05135  Yersinia infection
uah05163  Human cytomegalovirus infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113243505 (ARHGEF1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113243505 (ARHGEF1)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    113243505 (ARHGEF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113243505 (ARHGEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243505 (ARHGEF1)
   05205 Proteoglycans in cancer
    113243505 (ARHGEF1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113243505 (ARHGEF1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113243505 (ARHGEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113243505 (ARHGEF1)
Membrane trafficking [BR:uah04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    113243505 (ARHGEF1)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PH_13 AbiJ_NTD3
Other DBs
NCBI-GeneID: 113243505
NCBI-ProteinID: XP_026337967
UniProt: A0A3Q7VJ47
LinkDB
Position
Unknown
AA seq 987 aa
MPSTLLSASPVEPMEAEDIARGLAPGPPRPGLVPVSIIGAEDEDFENELETNAEEQNSQF
QSLEQVKRRPAHLMALLQHVALQFEPGPLLCCLHADMLASLGPKEAKKAFLDFYHSFLDK
TAVLRVQVPPTVAFELDRTRPDLLSEDVQRQFVQEVVQSQQASVSRLLEDFRSKRLMGMT
PWEHDLTQLEAWVGRDRASFEARERHLAERLLTHLEEMQHTISTDEEKSAAVVNAISLYM
RHLGVRTKSGDKKSGRNFFRKKMMGNRRSDEPTKTKKGLSIFLDAARWNRGEPQAPDFRH
LKVEADAEKPGLTEKRGGLGVPSRDRNFGAPGQDVPGVSLHPLSGDSPDREPGLDAAPEL
GDPPPQGPASLEPLAPPESTEEGADTERRWKRLSGRLGRSESLRVSDRRRPSRGSLGAKG
RGGGRSRSDVDMDPSSATAVLGPARRATPEPGDEGDPGRSGLELEPEEPPGWRELVPVGT
LHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFYQPMAEGGFFSQEELQNIFPSLDE
LIEVHSLFLDRLMKRRQDSGYLIEEIGDVLLARFDGAEGKWFQKISSRFCSRQSFALEQL
KVKQRKEPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPVERE
RVELAAECCREILHHVNQAVRDMEDLLRLKDYQKRLDLSHLRQSNDPMLSEFKNLDITKK
KLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRP
VLRLTSAMTREVATDHKAFYVIFTWDQEAQIYELVAQTVSERKNWCSLITDTAGSLKVPA
PASRPKSRPSPSSTREPLLSSSENGNGGGREIPPGDGRIERILSTLLPYCRPVPEGQLAA
RALEKVLSLKQLLFPSEEDSGAGPPREGDGVPGGGSQSPTQTQEIREKLLSLEETMKQLE
EVEEEFCRLRLLLSQLGENSFPQPGCT
NT seq 2964 nt   +upstreamnt  +downstreamnt
atgcctagcacactgttaagtgctagccctgtggagcccatggaggcagaggacatcgcc
cgcgggctggccccaggaccaccgcggcctggcctggtgccagtcagcatcatcggggct
gaggatgaggattttgagaacgagctggagacgaacgcagaggagcaaaacagccagttc
cagagcctggagcaggtgaagcggcggcctgcccacctcatggcgctcctgcagcacgtc
gccctgcagtttgaaccgggacctctgctctgttgccttcacgcggacatgctggcttcc
ctgggccccaaggaggccaagaaggccttcctcgacttctaccatagctttctggacaag
accgcggttttgcgggtacaagtccctcccactgtcgcctttgaacttgaccgcacgcgg
cccgacctcctctccgaggacgtccagcggcagttcgtgcaggaggtggtgcagagccag
caggcctccgtcagccggctgctggaggacttccgctccaagcggctcatgggcatgacg
ccctgggagcatgacctgacccagctggaggcctgggttgggcgggaccgggccagcttt
gaggcacgggagcggcacctagccgagcggctgctgacccacctggaggagatgcaacac
accatctctaccgatgaggaaaagagtgccgctgtggtcaacgccatcagcctgtacatg
cgccaccttggggtgcggaccaagagcggggacaagaagtcggggaggaatttcttccga
aaaaagatgatggggaaccggcggtcagatgagccaaccaagaccaagaaaggcctgagc
atcttcctggacgctgcccgctggaaccggggagagcctcaggccccagatttccgacac
ctcaaagtcgaggctgatgctgagaagccaggccttacggaaaagaggggaggcctgggg
gtgccctcccgggaccggaacttcggggctcctgggcaggatgtccctggagtttctctg
caccctctatctggagatagccctgaccgggaaccaggtcttgatgccgcaccagagctg
ggggacccgcccccacagggcccggccagcctggagcccctggcacccccggagagcacc
gaggagggtgctgacacagagagaaggtggaagaggctatcggggcgtctggggcgctcg
gagagcctgcgggtgagtgaccgccgccggccttcccggggcagcctcggggctaagggc
cggggtgggggccgctcccggagtgacgtggacatggaccccagctctgccacggccgtg
cttggccctgcccgacgagccacccctgagcctggagacgaaggggacccgggacggtca
ggactagagctggaaccggaagagccccctggctggcgggagctcgtccccgttggcacc
ctgcacagcctgcccaagagccaggtgaagcggcaggaggtcatcagcgagctgctggtg
acagaggccgcccacgtgcgcatgctccgggtgctgcatgacctcttctaccagcccatg
gcagaagggggcttcttctcccaggaggagctacagaacatctttcccagcctggacgag
ctcatcgaggtgcattccctgttcctcgatcggctaatgaagcggaggcaggatagtggc
tacctcattgaggagatcggagacgtactgctggcccggtttgatggtgccgaaggcaaa
tggttccagaaaatctcctcccgcttctgcagccgccagtcgtttgccttagagcagctc
aaagtcaagcagcgcaaggagcctcggttctgtgcctttgtgcaggaggcggagagccgc
ccgcggtgccgccgcctgcagctgaaggatatgatccccacggagatgcagcgtctgacc
aagtaccccctgctcctgcagagcatcgggcagaacacagaagagccggtggaacgggag
agagtggaactggcagccgagtgctgccgggagattctgcaccatgtgaaccaagccgtg
cgtgacatggaggacctgctgcggctcaaggattatcagaagcgcctggacttgtcccac
ctgcggcagagcaacgaccccatgctgagcgagttcaagaacctggacatcaccaaaaag
aagctggtgcatgagggcccgctgacatggcgggtgacaaaggacaaggctgtagaggtc
cacgtgctgctgctggacgacctgctgctgctgctccagcgccaagacgagcggctgctg
ctcaagtcccacagccggacgctgacgcccacgcccgacggcaagaccatgctgcggccc
gtgctgcggctcacgtccgccatgacccgcgaggtggctaccgatcacaaagccttctat
gtcatttttacgtgggaccaggaggcccagatatatgaactggtggcccagactgtgtcg
gaacgaaaaaactggtgttccctcatcaccgacactgctggatccttgaaggtccctgct
cccgcctctcgccccaaatcccggcccagccctagcagcacacgagaacccctgctcagc
agctcggagaatggcaacgggggtggccgagagatacccccaggggacggccggatagag
agaatcctcagcaccctcctgccctactgcaggcccgtccccgagggccagctcgctgcc
agggcccttgagaaagtgctatccctgaagcagctcctgtttccctcggaggaagacagt
ggggcagggcctccccgtgaaggggatggggtcccagggggtggctcccagagcccgacc
cagacccaggagattcgggagaagctgctcagcctggaggagaccatgaaacagctggag
gaggtggaggaggaattttgtcgcctgcgactcctcctgtctcagcttggggagaacagc
ttcccgcagcctggctgtacctga

KEGG   Ursus arctos horribilis: 113255216
Entry
113255216         CDS       T05909                                 

Gene name
ARHGEF28
Definition
(RefSeq) rho guanine nucleotide exchange factor 28 isoform X1
  KO
K21072  A-kinase anchor protein 28
Organism
uah  Ursus arctos horribilis
Pathway
uah05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113255216 (ARHGEF28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113255216 (ARHGEF28)
Membrane trafficking [BR:uah04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    113255216 (ARHGEF28)
SSDB
Motif
Pfam: PH_16 RhoGEF C1_1 PH C1_2 PH_13 PHD Prok-RING_1 Zf_RING
Other DBs
NCBI-GeneID: 113255216
NCBI-ProteinID: XP_026354577
UniProt: A0A3Q7WVX1
LinkDB
Position
Unknown
AA seq 1390 aa
MDSDSDSPFNYSWPSFPKMKIRRRASKQDHSFDVFKKSKHPPTFFAAGQLPDVLNGGDEV
YANSMVIDQVGDLDINYINIEGITTNACPESMGSTLGPQNRKHILTAETSHGQYPLSENK
EVTSNTEAQQSFPSPSSSYASNFNLSFGHHGFEKEQSHLKKRSSSLDALDADSEGEGHSE
QSHICYTPVSQSSSRTGIPSGDELDSFETTTEPDFNISRTESLSLSSNLQLKESLLSGVR
SRSYSCSSPKISVGKTRLVRDFTVCNTSEEQRAYSLPEPPREKRIQEEEWDKYIIPAKSE
SEKYKVSRTFSFLMNRMTSPRNKSKTKSKDVKDKEKLSRHQFVPGTFSGVLQCSVCDKTL
LGKESFQCSNCNANVHKGCKDAASPCTKKFQEKYNKNKSQTILGNSSFRDIPQPGLSLHP
SSSMPIGLPTGRKEASAQAHPLSRSVPGTALESFRRSGSSLESESDGNTWRSRSHSDELL
QSMGSSPSTESFLMEDVVDSSLWSDLSSDAQELEAESWSLVVDPLFCSKQEKDVIKRQDV
IFELMQTEMHHIRTLLIMSEIFRRGMKEELQLDHGTVDKIFPCLDELLEIHRHFFYSMKE
RRQESCAGDDRNFIISRIGDILVQQFSEENANQMKKIYGEFCSHHKEAVSLFKELQQNKK
FQNFIKLRNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKEGSEEHKDLCKALCL
IKDMIAAVDLKVSEYEKNQKWLEILTKIENKTYTKLKNGHVFRKQALISKERTLLHDGLV
YWKTATGRFKDILALLLTDVLLFLQEKDQKYIFAAVDQKPSVISLQKLIAREVANEERGM
FLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEDGGRTSESDEERRKAEARVA
RIQQCQEILSNQDQQICTYLEEKLHIYAELGELSGFEDVHLEPHLLIKPDPGEPPQAASL
LAAALREAESLQVAVKASQTGDACQSSEEGSGEPALTDTRSPPAEPGSSPASLVTEGTEG
RGCWDVDPGTQGVGTDLAVSDAGEKVEYRSFPVSSQSEIIQAIQNLTRLLYSLQAALTIQ
DSHIQVHRLVLQQQETLSPGPCFRGTPFQDQEKYRNLEKQREEMADIHKLQHRFQQEQRR
WHRSCDQQQREQEAKASRLQERERECRSQEELLLRNRGELDQQLQEYQQSLERLREGQRL
VERERERMRVQQSLLCGWRHSRQSSLPAVFSPGSAEVMELNRSESLCHENSFFINEALVQ
MSLNTYNKSTLSGVHQDATYPQNIANSDLVRTSENQVDLQLDVSPPLDVNHELWTAAGSC
HQIPPLHPRSKDSCKNDLDMSQTEFPTPHDSNPHGSQLQTFMAEAKLNLQTLTREDGETG
DGAEENIVYL
NT seq 4173 nt   +upstreamnt  +downstreamnt
atggattctgactctgactccccttttaactactcgtggccttccttccccaaaatgaag
attcgccggagggcgtccaagcaagatcactcttttgatgtcttcaagaaatccaagcat
cctccaacattctttgctgcaggccagctccctgacgtgctgaatggcggcgatgaagtt
tatgctaactctatggtgatagatcaggttggtgatttggatattaactacattaatata
gaaggaatcactacaaacgcctgccctgaatccatgggttctactctggggcctcagaac
cgcaagcatatcctgactgctgaaaccagccatggacaatacccactaagtgagaacaag
gaagtgacgtcaaatactgaagctcagcagtccttcccatcaccatctagttcatatgct
tccaattttaatctttcctttggtcatcatggatttgaaaaggaacaaagtcatctgaag
aaaagaagttctagccttgatgccctggatgctgacagtgaaggggaagggcattctgaa
cagtcacacatttgctacacgccagtgtctcagagttcctcaagaactgggattcctagt
ggggatgaattggactcttttgagaccaccactgaaccagatttcaatatctccaggaca
gagtcactttctttatcaagtaacctgcagttgaaggaatccttgctttctggagtccgc
tcacgttcttactcctgctcatcacccaaaatttctgtaggaaaaactcggttggtgcgt
gattttacagtgtgcaatactagtgaagagcaaagagcttacagcttaccggagccacca
agagaaaaaagaattcaggaagaagaatgggataaatacattatacctgccaagtctgag
tctgaaaaatacaaagtgagccgcactttcagcttcctcatgaataggatgacaagccct
cggaataaatctaagacaaaaagcaaggatgtcaaagacaaagagaagctgagccgacat
cagtttgtccctggaacattctctggggttctacagtgttcggtctgtgataaaacgctc
ctggggaaggagtcattccagtgttccaactgtaatgcaaacgtacacaagggttgtaaa
gacgctgcatctccgtgtaccaagaaattccaagagaaatacaacaagaacaaatcgcag
accatccttggaaactcttcatttcgagacatcccacagcctggtctctccttgcaccct
tcttcctccatgcctattggattgcccactgggagaaaagaagcttcagcacaggcccat
cctttgtccagaagtgttccaggcactgccttggaaagcttcagaaggtcggggtcatcc
ctggagtctgagagtgacgggaacacctggagaagcaggtctcattctgatgagctgcta
cagtccatgggctcttctccctccacggaatccttcttaatggaagatgtcgtggattct
tctctgtggagtgacctcagcagtgatgcccaggagttggaagcagaatcttggagtctg
gtggtggaccccttgttttgcagtaagcaggagaaagatgtcatcaaaagacaagatgtc
attttcgagctgatgcagacggagatgcaccacatccggacgctgctcatcatgtctgag
atcttcaggagaggaatgaaggaggagctgcagctggatcacggcaccgtggataaaatc
ttcccctgcttagatgagttacttgaaatccacaggcatttcttttatagcatgaaggag
cgaaggcaggagtcctgtgctggtgatgacaggaatttcatcatcagccgaattggagat
attctagttcagcagttttcagaagaaaatgcaaatcaaatgaagaaaatatatggagaa
ttctgtagccatcacaaagaagctgttagcctctttaaagaactccaacaaaataaaaag
tttcagaattttattaagcttcgaaatagtaatctcttggctcgacgccgaggaattcca
gagtgcatcctgctggtcacccagcgcatcacaaaataccctgtcctggtggaaaggatt
ctgcaatacacaaaggaaggaagtgaagaacataaagacttgtgcaaagccctgtgctta
attaaagacatgattgcagcagtggatttaaaagtcagcgagtatgagaaaaaccaaaaa
tggcttgagatcctaactaagatcgaaaacaaaacctacacaaagctcaaaaacggccat
gtgttcaggaagcaagcactgataagtaaagaaaggactctcttacatgatggccttgtt
tactggaaaactgctacgggtcgtttcaaagatatcctggctctacttctaactgatgtg
ctgctctttttacaagaaaaagaccagaaatacatctttgcagctgttgatcagaagcct
tcggttatttcccttcagaagctcattgctagagaagttgccaatgaggaaagaggaatg
tttctaatcagtgcttcgtctgcgggtcctgagatgtatgaaattcataccaactccaag
gaggaacgaaataactggatgagacgaatccaacaggcagtagaaagttgcccagaagaa
gacgggggaaggacaagcgaatctgatgaagagaggcggaaagctgaagcaagagtggcc
agaattcagcaatgtcaagaaatactcagtaaccaagaccaacaaatttgcacatatttg
gaggagaagctgcatatctatgctgaacttggagaactgagtggatttgaggatgtccat
ctagagccccacctcctcattaaaccggacccaggagagcctccccaggcagcctcatta
ctagcagcagctctgagagaagctgagagcctccaagttgcagtgaaggcctcacaaacg
ggcgatgcctgtcagtcatccgaggaaggttctggagaacctgccttgacagatacgcgg
agtccccccgcagagccaggatcgtctccagcttcactagtcacagaagggacagaagga
agaggctgttgggatgtggatcctggcacccagggtgtgggaaccgacttggcggtctct
gatgcaggggagaaggtggaatatagaagtttcccagtttcttcacagtcagagattata
caagcgatacagaatttaacccggctgctatatagccttcaggctgccttgaccatccag
gatagccacatccaggtccacaggctggttctccagcagcaggagaccctttcccccggc
ccgtgcttccgagggacccccttccaggaccaggagaagtaccgcaacctggagaagcag
cgggaagagatggccgacatccacaagctgcagcaccggttccagcaggagcagcggcgc
tggcaccgcagctgtgaccagcagcagcgggagcaggaggccaaggccagccggctgcag
gagcgggagagggagtgccggtcgcaggaggagctgctgctcaggaaccgcggggagctg
gaccagcagctccaggagtaccagcagagcctggagcggctgagggagggccagcgcctg
gtggagagggagagggagcggatgcgggtccagcagagcctgctgtgtggttggagacac
agtcggcagagtagccttcccgccgtgttttctccaggaagcgcagaggtaatggaactt
aatcgatccgagagtttgtgtcatgaaaattcgttcttcattaatgaagctttagtacaa
atgtcccttaacacatacaacaagtcgactctatcaggtgtccatcaggatgccacttat
ccccagaatatagctaattctgatttggtaaggactagtgaaaatcaagtagacctccag
ttggacgtttctccgcccttggatgtcaaccatgaactgtggacagccgctgggtcctgt
catcagataccccctctccacccacgcagcaaggattcttgtaaaaatgatttggacatg
tctcagactgagttcccaaccccccatgactccaatccacatggctctcagctgcagaca
tttatggcagaagcaaagctaaatctacagacactgaccagagaagacggggaaactgga
gatggagctgaagaaaatattgtttacctttaa

KEGG   Ursus arctos horribilis: 113259947
Entry
113259947         CDS       T05909                                 

Gene name
ARHGEF12
Definition
(RefSeq) rho guanine nucleotide exchange factor 12 isoform X1
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
uah  Ursus arctos horribilis
Pathway
uah04270  Vascular smooth muscle contraction
uah04360  Axon guidance
uah04611  Platelet activation
uah04625  C-type lectin receptor signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05135  Yersinia infection
uah05152  Tuberculosis
uah05163  Human cytomegalovirus infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113259947 (ARHGEF12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113259947 (ARHGEF12)
   04625 C-type lectin receptor signaling pathway
    113259947 (ARHGEF12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113259947 (ARHGEF12)
  09158 Development and regeneration
   04360 Axon guidance
    113259947 (ARHGEF12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113259947 (ARHGEF12)
   05205 Proteoglycans in cancer
    113259947 (ARHGEF12)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113259947 (ARHGEF12)
   05152 Tuberculosis
    113259947 (ARHGEF12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113259947 (ARHGEF12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113259947 (ARHGEF12)
Membrane trafficking [BR:uah04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    113259947 (ARHGEF12)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 PH_13 Ribonuc_2-5A Tricorn_PDZ
Other DBs
NCBI-GeneID: 113259947
NCBI-ProteinID: XP_026361334
UniProt: A0A3Q7X456
LinkDB
Position
Unknown
AA seq 1543 aa
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAAVTSSKPLGDALTVSEVEADPSDGLSRIDSSSGDAS
RPSSDSADSPKSALKERIYLEENPEKSEVIQDTDTQSLIGSPSPRIAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
VFLEFHQFFLDRSAHLKVSVPDEISVDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRVTLEKERACAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKQRHPKHLSTPSSVSPEPQDPAKLRQSGLAGEGTDVGY
LPANSMSSVASGATLSQEGGKENDTGSKQLGETPASGDCVDGTPRTPNTVFDFPPPPLDQ
VQEEEWEVERVTEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPSEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKSVRKRNETSVIDQIGEDLLTWFSGPGEDKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSAK
PIPLPQSPPCEGDNDEEAAPKLKVGHHSISVPGLQSPDRDLGLESPLMSSKPQSHSLGTS
GKSEVDDLFVAERQFAKEQHADGTLQEAGASYQIPIPDPHLPASEERWALDALRNLGLLK
QLLVQQLGLTEKSTQEDWPHFPRYRTASSGVQTNGGAQNSENSKACPPGEGQMPFRTGIG
DIATCYSPRTSAESSAPRDSVVLAFQDSQASNILVMDHMVMTPEMPPAEPEGSLDESGEH
FFDAREAHSDDNPSEGDGAVRKEEDVTLRISGNYLILDGYEAVQESSTDEDVASSLPPPP
PAGIPSTDSARPHQHSPQRAHSDGAASPFTPEFLLQQRWGAMEDSCFEIQSPPSCADSQS
QIMEYIRKIEADLEHLKKVEESYSMLCQRLAGSALTDKHSDKS
NT seq 4632 nt   +upstreamnt  +downstreamnt
atgagtggcacacagtctactatcaccgacaggtttcccctcaaaaaacctataaggcat
gggagtattttgaaccgagagtcaccaacagataagaagcagaaagttgagcgcagtgca
tcacatgattttgatcctacagatagctcctccaagaagacaaagtctagttcagaggag
agtagatccgagatatatggtcttgttcagcgttgcgtgatcatccagaaggatgacaat
ggatttgggctgacggtcagtggagacaatccagtcttcgtacagtctgtcaaagaagat
ggagcagccatgcgggctggggtacagacaggtgatcgaatcatcaaggtgaatggaact
ctggtgactcattcaaaccatttggaagtggtgaagctaatcaaatctggttcctatgta
gctctcactgttcagggacgcccacctgggtcgccccagattccactcgccgattctgaa
gtagagccatcagtcattggacatatgtctcccatcatgacatcccctcattcacctgga
gcatctgggaacatggagagaattactagtcctgtgctcatgggggaggaaaacaatgtg
gttcataaccagaaagtagaaattctgagaaaaatgttacagaaagaacaggaacggcta
cagttattgcaggaagattacaaccgaacacctgcccaaagattgctaaaagagatccaa
gaggccaagaaacacattcctcagctgcaagagcagttatccaaagccacgggctctgct
caggatggagctgcagttacatcctccaagcctttaggtgacgcactgacagtcagtgag
gtggaagctgatcctagtgatggactaagcagaattgactctagcagtggagacgcttct
cggcccagtagtgacagcgcagacagtcccaagagtgccctgaaagagaggatttatcta
gaggaaaacccagagaaaagcgaagtgattcaggacactgatactcagtcactcattggg
agtccctctccccgtatagcacctcatattattggagcagaggatgatgatttcggtact
gaacatgaacagatcaatgggcagtgcagctgtttccagagcatcgagctgctgaaatct
cgccctgctcacctggctgttttcttacaccacgtggtctcacagtttgaccccgcgacg
ctgctctgttatctctattcagacctgtacaagcagaccaattccaaggagactcgtcgt
gtcttccttgagtttcatcagttcttcctggatcgatctgcacacctgaaagtttctgtg
cctgatgaaatatcagtagatctagaaaaaagaagacctgagcttatacccgaggatctg
caccgccactatatccaaactatgcaggaaagagtccacccagaagttcagaggcacttg
gaagattttcggcagaagcgtagcatggggctgaccttggctgaaagcgaactgactaaa
cttgacgcagagcgagacaaggaccgggtcactttggagaaggaacgggcatgtgcagaa
cagatcgttgccaaaattgaagaagtgttgatgactgctcaggctgtagaagaagataag
agttcaacaatgcagtatgttatccttatgtacatgaagcatttgggggtaaaagtgaaa
gaacctcgaaatttggagcacaagcggggtcggattggattccttccaaaaatcaagcag
agtatgaagaaagatcgagaaggcgaagaaaaagggaagcgcagaggattccccagcatc
ctgggacccccaaggagaccaagccgtcatgacaatagtgcaattggcagggccatggag
ctacagaaacagcggcacccaaagcacttatccacaccctcttccgtgagtcctgagcct
caggaccctgctaagttgcgccagagtgggttagcaggtgaaggaacggacgtcggatac
ctgccagccaattccatgtcctctgtggcttcaggggccactctttcccaggaaggaggg
aaagagaatgatacaggatcaaagcaacttggagaaacaccagcatctggagactgcgta
gatggcacccctcggactccgaatactgtctttgatttcccacctcctcctttagaccaa
gtgcaggaggaggaatgggaagtggaaagggtgactgaacatgggacaccaaagcccttt
cgaaagtttgacagcatagcttttggagaaagtcaaagtgaggatgaacagtttgaaaat
gacttagagacagacccaccgaactggcaacagctcgttagtcgagaagtgttactggga
ctaaagccttctgagatcaaaagacaggaagtaattaatgaattgttctacactgaaaga
gctcatgttcgaacactgaaagttcttgatcaagtattctatcagcgagtgtccagagaa
ggaattctgtcaccttcagaactacggaaaattttttcaaacttggaagatattcttcaa
cttcatattggattgaatgagcaaatgaagtctgttcgaaagaggaatgagacctcagtt
attgatcagattggggaagatttgctgacctggttcagtggaccaggagaggacaagttg
aagcacgctgctgctaccttttgcagtaaccagcctttcgccctggaaatgatcaagtct
cgtcagaaaaaggattctcgattccagacctttgtgcaagatgctgagagtaatcctctg
tgtcgtcgtctgcagctgaaggatatcattcctacccaaatgcagaggcttaccaagtac
cctcttctgttggataatattgccaaatacacagaatggccaacggaaagggagaaggtg
aagaaagctgcagatcactgtcgtcagatcttgaattatgtaaatcaggctgtcaaggag
gcagaaaataaacagcgtttagaagactatcagcgtcgtctggatacctccaatctgaag
ttgtcagagtacccaaacgtggaagagctcaggaatttggatttaacaaaaaggaagatg
attcatgaagggccattggtctggaaggtgaaccgagataaaactattgatctatacacg
ttgctgctggaagacattcttgtattgttacaaaagcaggatgacagactggtgttaaga
tgtcatagtaagattctggcgtctaccgctgacagcaaacacacatttagccctgtcatt
aagttgagtacagtgttggttcgacaagtggcaacagataacaaagctttatttgtcatc
tctatgtcagacaatggagcccaaatttatgaactggtggcacagacagtttccgaaaag
actgtctggcaagacctaatctgtcggatggccgcatccgtgaaggaacaatccgcaaag
cccatcccgttgccacagtcaccaccttgcgaaggagacaacgatgaagaagcagctcca
aagttaaaggtgggacaccacagcatttcggtccctggtctgcagagtccagacagagat
ttgggattagagtctcccttaatgtcgtcaaaacctcagtctcattcactggggacctct
gggaaatccgaggtagatgatctgtttgtggccgagaggcagtttgctaaggagcagcat
gcagatgggactctgcaggaagccggagcaagttatcagatcccaatcccagacccacac
ttgcctgcctcggaagaacggtgggcactggatgcactgaggaatttgggcttgctgaag
cagttgcttgtccaacagctgggtttgactgagaagagcactcaggaagactggccacat
ttcccaagatacaggacagcgtcttcaggggtgcagacaaacggtggagcccagaactct
gagaatagtaaggcctgtcctcctggtgaaggacagatgccctttagaactggaattggt
gacattgcaacttgttacagtccacggacttcagctgaatcttcggctccgcgggattca
gtggtactggcattccaagatagccaggcaagtaacattttagtaatggaccacatggtt
atgaccccagagatgcctcctgcggagccagaagggagtctcgatgagagtggagagcac
ttttttgatgcccgtgaagcacacagtgatgataacccatcagaaggtgatggagcggtt
cggaaggaagaggatgttactttgcgcatctcaggaaactatctgattcttgacggctat
gaagcggtgcaggagagctccacggatgaggacgttgcttcctcgctccccccgccgccc
ccggcaggcatcccctccacagactctgcccgcccgcaccagcactcgccccagcgtgcc
cattccgacggggcggcttcaccgttcacccccgaattcctgctccagcagcgctggggg
gctatggaggattcctgttttgagatccagagtcccccctcttgtgcagactctcagagc
cagatcatggagtacattcggaagatcgaggctgaccttgaacacttaaagaaggtggaa
gaaagttacagcatgctttgccaaaggctggctggatcagccctcacagacaagcactca
gataaaagttag

DBGET integrated database retrieval system