KEGG   Ursus arctos horribilis: 113243540
Entry
113243540         CDS       T05909                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 isoform X1
  KO
K13375  transforming growth factor beta-1
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04068  FoxO signaling pathway
uah04110  Cell cycle
uah04218  Cellular senescence
uah04350  TGF-beta signaling pathway
uah04380  Osteoclast differentiation
uah04390  Hippo signaling pathway
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04926  Relaxin signaling pathway
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05220  Chronic myeloid leukemia
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
uah05410  Hypertrophic cardiomyopathy (HCM)
uah05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113243540 (TGFB1)
   04350 TGF-beta signaling pathway
    113243540 (TGFB1)
   04390 Hippo signaling pathway
    113243540 (TGFB1)
   04068 FoxO signaling pathway
    113243540 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113243540 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113243540 (TGFB1)
   04218 Cellular senescence
    113243540 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113243540 (TGFB1)
   04672 Intestinal immune network for IgA production
    113243540 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    113243540 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113243540 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243540 (TGFB1)
   05205 Proteoglycans in cancer
    113243540 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113243540 (TGFB1)
   05212 Pancreatic cancer
    113243540 (TGFB1)
   05225 Hepatocellular carcinoma
    113243540 (TGFB1)
   05226 Gastric cancer
    113243540 (TGFB1)
   05220 Chronic myeloid leukemia
    113243540 (TGFB1)
   05211 Renal cell carcinoma
    113243540 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113243540 (TGFB1)
   05321 Inflammatory bowel disease (IBD)
    113243540 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    113243540 (TGFB1)
   05414 Dilated cardiomyopathy (DCM)
    113243540 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113243540 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113243540 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113243540 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243540 (TGFB1)
   05161 Hepatitis B
    113243540 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113243540 (TGFB1)
   05144 Malaria
    113243540 (TGFB1)
   05145 Toxoplasmosis
    113243540 (TGFB1)
   05140 Leishmaniasis
    113243540 (TGFB1)
   05142 Chagas disease (American trypanosomiasis)
    113243540 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:uah03110]
    113243540 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243540 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113243540 (TGFB1)
Chaperones and folding catalysts [BR:uah03110]
 Intramolecular chaperones
  Others
   113243540 (TGFB1)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   113243540 (TGFB1)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113243540 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 113243540
NCBI-ProteinID: XP_026338022
UniProt: A0A3Q7VJ99
LinkDB
Position
Unknown
AA seq 391 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVENTNKI
YEKIKKSPHSIYMLFNTSELREAVPEPVLLSRAELRLLRLKLKAEQHVELYQKYSNDSWR
YLSNRLLAPSDTPEWLSFDVTGVVRQWLSHGGEVEGFRLSAHCSCDSKDNTLQVDINAGF
SSSRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctgccgctgctgtggctactagtg
ctgacgcctggccggccggccgccggactgtccacctgcaagaccatcgacatggaactg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggctgtgctggccctt
tacaacagtacccgcgaccgggtggcgggggagagcgccgagccggagcccgagcctgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacaccaacaaaatc
tatgagaaaatcaagaaaagcccacacagcatctatatgctcttcaacacatcggagctc
cgagaagcagtgcccgagcccgtcttgctctcccgggcggagctgcgcctgctgaggctc
aagttgaaagccgagcagcacgtggagctgtaccagaaatatagcaacgattcctggcgc
tacctcagcaaccggctgctggcgcccagcgacacgccagaatggctgtccttcgatgtc
acaggagtcgtgcgacagtggctgagccatggaggggaagtagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataatacactgcaagtggatatcaacgcagggttc
agttccagccgccgaggtgacctggccaccattcacggcatgaaccggcccttcctgctc
ctcatggccaccccactggagagggcccagcacctgcacagctcccggcatcgccgggcc
ctggacaccaactactgcttcagctccaccgaaaagaactgctgcgtacggcagctctac
atcgacttccgcaaggatctgggctggaagtggatccacgagcccaagggctaccacgcc
aacttctgcctggggccctgcccctacatttggagcctggacacgcagtacagcaaggtc
ctggcgctgtacaaccagcacaacccgggcgcgtcggcggcgccgtgctgcgtgccgcag
gctctggagcccctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Ursus arctos horribilis: 113268733
Entry
113268733         CDS       T05909                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04068  FoxO signaling pathway
uah04110  Cell cycle
uah04218  Cellular senescence
uah04350  TGF-beta signaling pathway
uah04380  Osteoclast differentiation
uah04390  Hippo signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05220  Chronic myeloid leukemia
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
uah05410  Hypertrophic cardiomyopathy (HCM)
uah05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113268733 (TGFB2)
   04350 TGF-beta signaling pathway
    113268733 (TGFB2)
   04390 Hippo signaling pathway
    113268733 (TGFB2)
   04068 FoxO signaling pathway
    113268733 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268733 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113268733 (TGFB2)
   04218 Cellular senescence
    113268733 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113268733 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113268733 (TGFB2)
   05206 MicroRNAs in cancer
    113268733 (TGFB2)
   05205 Proteoglycans in cancer
    113268733 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113268733 (TGFB2)
   05212 Pancreatic cancer
    113268733 (TGFB2)
   05225 Hepatocellular carcinoma
    113268733 (TGFB2)
   05226 Gastric cancer
    113268733 (TGFB2)
   05220 Chronic myeloid leukemia
    113268733 (TGFB2)
   05211 Renal cell carcinoma
    113268733 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113268733 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    113268733 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    113268733 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    113268733 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113268733 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113268733 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113268733 (TGFB2)
   05161 Hepatitis B
    113268733 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113268733 (TGFB2)
   05144 Malaria
    113268733 (TGFB2)
   05145 Toxoplasmosis
    113268733 (TGFB2)
   05140 Leishmaniasis
    113268733 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    113268733 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113268733 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113268733 (TGFB2)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   113268733 (TGFB2)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113268733 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 113268733
NCBI-ProteinID: XP_026373101
UniProt: A0A3Q7WJC6
LinkDB
Position
Unknown
AA seq 414 aa
MHYCVLSAFLFLHLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgttcctgcatctggtcacggccgcgctcagc
ctgtctacctgcagcacgctcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagattctgagcaagctgaagctcaccagccccccagaagactatcccgaaccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcttgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaaatgccatcccgccc
actttctacagaccctacttcagaattgtccgatttgacgtctcggcgatggagaagaat
gcatccaatttggtgaaagcagagttcagagtctttcgtttacagaacccgaaagccagg
gtgccggaacaacggatcgaactgtatcagattctcaaatccaaagatttaacgtctcca
acccagcgctacattgacagtaaagttgtcaagacgagagcagaaggcgaatggctttcc
tttgacgtgactgacgccgtccatgaatggctccaccataaagacagaaacctgggattt
aaaataagtttgcactgtccctgctgcacctttgtaccatctaataattacatcattccc
aataaaagcgaagagctagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttgttgccctcctacagacttgagtcacaacagtccaaccggcggaag
aagcgtgctttggatgcagcctattgttttagaaatgtgcaggataattgctgcctccgt
ccactttacatagatttcaagagggatcttgggtggaaatggatacatgaacctaaaggg
tacaatgccaacttctgtgctggagcgtgcccatatttatggagttcggacactcagcac
agtagggttctcagcctatataataccataaatccagaagcatctgcttctccttgctgc
gtgtcccaggatttagaaccgctaaccattctctactacattggcaaaacacccaagatt
gaacaactctctaatatgatcgtcaagtcttgcaaatgcagctaa

KEGG   Ursus arctos horribilis: 113270312
Entry
113270312         CDS       T05909                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04068  FoxO signaling pathway
uah04110  Cell cycle
uah04218  Cellular senescence
uah04350  TGF-beta signaling pathway
uah04390  Hippo signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05220  Chronic myeloid leukemia
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
uah05410  Hypertrophic cardiomyopathy (HCM)
uah05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113270312 (TGFB3)
   04350 TGF-beta signaling pathway
    113270312 (TGFB3)
   04390 Hippo signaling pathway
    113270312 (TGFB3)
   04068 FoxO signaling pathway
    113270312 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113270312 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113270312 (TGFB3)
   04218 Cellular senescence
    113270312 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113270312 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113270312 (TGFB3)
   05212 Pancreatic cancer
    113270312 (TGFB3)
   05225 Hepatocellular carcinoma
    113270312 (TGFB3)
   05226 Gastric cancer
    113270312 (TGFB3)
   05220 Chronic myeloid leukemia
    113270312 (TGFB3)
   05211 Renal cell carcinoma
    113270312 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113270312 (TGFB3)
   05321 Inflammatory bowel disease (IBD)
    113270312 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    113270312 (TGFB3)
   05414 Dilated cardiomyopathy (DCM)
    113270312 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113270312 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113270312 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113270312 (TGFB3)
   05161 Hepatitis B
    113270312 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113270312 (TGFB3)
   05144 Malaria
    113270312 (TGFB3)
   05145 Toxoplasmosis
    113270312 (TGFB3)
   05140 Leishmaniasis
    113270312 (TGFB3)
   05142 Chagas disease (American trypanosomiasis)
    113270312 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113270312 (TGFB3)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   113270312 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 113270312
NCBI-ProteinID: XP_026375256
UniProt: A0A3Q7WQV4
LinkDB
Position
Unknown
AA seq 412 aa
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMQGEREDSCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRSEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDSEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggactttggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaaactcaggctcaccagtccccccgagccatcg
gtgatgacccacgtcccctaccaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcagggggagagggaggacagctgcactcaggaaaacaccgagtcggagtac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaatgagctg
gccgtctgccccaaagggatcacctccaaggttttccgcttcaacgtgtcctcagtggag
aaaaatggaaccaacctgttccgagcagaattccgggtcttgcgggtgcccaaccccagc
tccaagcgcagcgaacaaaggatcgagctcttccagatactccggcccgatgagcacatt
gccaaacagcgctatatcggcggcaagaatctgcccacacggggcaccgccgagtggctg
tcctttgacgtcactgacactgtgcgtgagtggctcttgcgaagagagtccaacttaggt
ctggaaatcagcattcactgtccatgtcacacctttcagcccaatggtgacatcctggaa
aacattcatgaggtgatggaaatcaaattcaaaggtgtggacagcgaggatgatcatggc
cgtggggacctagggcgcctcaagaagcagaaggaccaccacaaccctcacctcatcctg
atgatgattcccccgcaccggctggacaacccgggccagggcgggcagaggaagaagcgg
gccctggacaccaattactgcttccgcaatttggaggagaactgctgtgtgcgccctctc
tacattgacttccgacaagatctgggctggaaatgggtccatgaacctaagggctactac
gccaacttctgctcaggcccttgcccctacctccgcagcgcggacacaacccacagcacg
gtgctgggactgtacaacactctgaatcctgaagcatccgcctcaccttgctgtgtgccc
caggacttggagcccctgaccatcctgtactacgtcgggaggacccccaaggtggaacag
ctgtctaacatggtggtcaagtcctgtaagtgtagctga

DBGET integrated database retrieval system