KEGG   Ursus arctos horribilis: 113243572
Entry
113243572         CDS       T05909                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04261  Adrenergic signaling in cardiomyocytes
uah04370  VEGF signaling pathway
uah04371  Apelin signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04728  Dopaminergic synapse
uah04910  Insulin signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04920  Adipocytokine signaling pathway
uah04922  Glucagon signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04973  Carbohydrate digestion and absorption
uah05010  Alzheimer disease
uah05017  Spinocerebellar ataxia
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113243572 (AKT2)
   04015 Rap1 signaling pathway
    113243572 (AKT2)
   04010 MAPK signaling pathway
    113243572 (AKT2)
   04012 ErbB signaling pathway
    113243572 (AKT2)
   04370 VEGF signaling pathway
    113243572 (AKT2)
   04371 Apelin signaling pathway
    113243572 (AKT2)
   04630 Jak-STAT signaling pathway
    113243572 (AKT2)
   04668 TNF signaling pathway
    113243572 (AKT2)
   04066 HIF-1 signaling pathway
    113243572 (AKT2)
   04068 FoxO signaling pathway
    113243572 (AKT2)
   04072 Phospholipase D signaling pathway
    113243572 (AKT2)
   04071 Sphingolipid signaling pathway
    113243572 (AKT2)
   04024 cAMP signaling pathway
    113243572 (AKT2)
   04022 cGMP-PKG signaling pathway
    113243572 (AKT2)
   04151 PI3K-Akt signaling pathway
    113243572 (AKT2)
   04152 AMPK signaling pathway
    113243572 (AKT2)
   04150 mTOR signaling pathway
    113243572 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113243572 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    113243572 (AKT2)
   04218 Cellular senescence
    113243572 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113243572 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    113243572 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113243572 (AKT2)
   04620 Toll-like receptor signaling pathway
    113243572 (AKT2)
   04625 C-type lectin receptor signaling pathway
    113243572 (AKT2)
   04660 T cell receptor signaling pathway
    113243572 (AKT2)
   04662 B cell receptor signaling pathway
    113243572 (AKT2)
   04664 Fc epsilon RI signaling pathway
    113243572 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    113243572 (AKT2)
   04062 Chemokine signaling pathway
    113243572 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113243572 (AKT2)
   04922 Glucagon signaling pathway
    113243572 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    113243572 (AKT2)
   04920 Adipocytokine signaling pathway
    113243572 (AKT2)
   04929 GnRH secretion
    113243572 (AKT2)
   04915 Estrogen signaling pathway
    113243572 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    113243572 (AKT2)
   04917 Prolactin signaling pathway
    113243572 (AKT2)
   04926 Relaxin signaling pathway
    113243572 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    113243572 (AKT2)
   04919 Thyroid hormone signaling pathway
    113243572 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113243572 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    113243572 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    113243572 (AKT2)
   04728 Dopaminergic synapse
    113243572 (AKT2)
   04722 Neurotrophin signaling pathway
    113243572 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113243572 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    113243572 (AKT2)
   04213 Longevity regulating pathway - multiple species
    113243572 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243572 (AKT2)
   05205 Proteoglycans in cancer
    113243572 (AKT2)
   05230 Central carbon metabolism in cancer
    113243572 (AKT2)
   05231 Choline metabolism in cancer
    113243572 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113243572 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113243572 (AKT2)
   05212 Pancreatic cancer
    113243572 (AKT2)
   05225 Hepatocellular carcinoma
    113243572 (AKT2)
   05226 Gastric cancer
    113243572 (AKT2)
   05214 Glioma
    113243572 (AKT2)
   05221 Acute myeloid leukemia
    113243572 (AKT2)
   05220 Chronic myeloid leukemia
    113243572 (AKT2)
   05218 Melanoma
    113243572 (AKT2)
   05211 Renal cell carcinoma
    113243572 (AKT2)
   05215 Prostate cancer
    113243572 (AKT2)
   05213 Endometrial cancer
    113243572 (AKT2)
   05224 Breast cancer
    113243572 (AKT2)
   05222 Small cell lung cancer
    113243572 (AKT2)
   05223 Non-small cell lung cancer
    113243572 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113243572 (AKT2)
   05017 Spinocerebellar ataxia
    113243572 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113243572 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113243572 (AKT2)
   04931 Insulin resistance
    113243572 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113243572 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113243572 (AKT2)
   05135 Yersinia infection
    113243572 (AKT2)
   05152 Tuberculosis
    113243572 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243572 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    113243572 (AKT2)
   05162 Measles
    113243572 (AKT2)
   05164 Influenza A
    113243572 (AKT2)
   05161 Hepatitis B
    113243572 (AKT2)
   05160 Hepatitis C
    113243572 (AKT2)
   05168 Herpes simplex virus 1 infection
    113243572 (AKT2)
   05163 Human cytomegalovirus infection
    113243572 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243572 (AKT2)
   05169 Epstein-Barr virus infection
    113243572 (AKT2)
   05165 Human papillomavirus infection
    113243572 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243572 (AKT2)
   05142 Chagas disease (American trypanosomiasis)
    113243572 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113243572 (AKT2)
   01524 Platinum drug resistance
    113243572 (AKT2)
   01522 Endocrine resistance
    113243572 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113243572 (AKT2)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113243572 (AKT2)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   113243572 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 113243572
NCBI-ProteinID: XP_026338084
UniProt: A0A3Q7V5C6
LinkDB
Position
Unknown
AA seq 525 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPDAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDPSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAREVMEHRFFLSVNWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRFFSSALRQTHLSGLSGPASRILSSP
LCPDQNLGDSPLPAPGPGLRAVGEIPVFNQHKPLRGASRGAAGPA
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaggaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccccggtacttcctgttgaagagtgacggctccttcattggatacaaggag
cggcctgacgcccctgaccagaccctgccccccctgaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagagaccacggcccaacacctttgtcatacgctgcctgcagtgg
accacggtcatcgagaggaccttccacgtagactctccagatgagagggaggagtggatg
cgggccattcagatggttgccaacagcctcaagcagcggggcccaggtgaggaccccatg
gactataagtgtggctcccccagcgacccttctgcagccgaggagatggaagtggcagtt
agcaaggctcgggccaaggtgaccatgaatgacttcgactatctcaaacttctgggcaag
ggcacctttggcaaagtgattctggtgcgggagaaagccagcggccgctactatgccatg
aagatcctgcggaaggaagttatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgggtcctccagaacaccaggcacccattcctcaccgcactgaagtatgccttccag
acccacgaccgcctgtgcttcgtgatggagtatgccaacggtggtgagctgtttttccac
ctgtcccgggagcgtgtcttcacggaggagcgggctcgcttctacggtgcagagatagtc
tctgccctcgagtatttgcactcgcgggatgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgacttcggcctgtgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtgggacacccgagtacctggcacccgag
gtgctggaggacaacgactacggccgcgcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcctttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagcgatgcc
agggaggtcatggagcacaggttcttcctcagcgtcaactggcaggacgtggtacagaag
aagcttctgccccccttcaaacctcaggtcacctccgaggttgacacaaggtactttgac
gatgagtttaccgcccagtccatcacaatcacgcccccggaccgctttttttcttcagcc
ctccgccaaactcacctcagcggtctcagcggccctgcctccaggatcctgtcctcacct
ttgtgcccagaccagaatttgggagactctccactgcccgccccaggaccaggccttcgg
gcggttggagagattccggtttttaatcaacacaagcccctgcgaggggcgtcgcgtgga
gctgcgggtcctgcctga

KEGG   Ursus arctos horribilis: 113262966
Entry
113262966         CDS       T05909                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04261  Adrenergic signaling in cardiomyocytes
uah04370  VEGF signaling pathway
uah04371  Apelin signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04728  Dopaminergic synapse
uah04910  Insulin signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04920  Adipocytokine signaling pathway
uah04922  Glucagon signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04973  Carbohydrate digestion and absorption
uah05010  Alzheimer disease
uah05017  Spinocerebellar ataxia
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113262966 (AKT3)
   04015 Rap1 signaling pathway
    113262966 (AKT3)
   04010 MAPK signaling pathway
    113262966 (AKT3)
   04012 ErbB signaling pathway
    113262966 (AKT3)
   04370 VEGF signaling pathway
    113262966 (AKT3)
   04371 Apelin signaling pathway
    113262966 (AKT3)
   04630 Jak-STAT signaling pathway
    113262966 (AKT3)
   04668 TNF signaling pathway
    113262966 (AKT3)
   04066 HIF-1 signaling pathway
    113262966 (AKT3)
   04068 FoxO signaling pathway
    113262966 (AKT3)
   04072 Phospholipase D signaling pathway
    113262966 (AKT3)
   04071 Sphingolipid signaling pathway
    113262966 (AKT3)
   04024 cAMP signaling pathway
    113262966 (AKT3)
   04022 cGMP-PKG signaling pathway
    113262966 (AKT3)
   04151 PI3K-Akt signaling pathway
    113262966 (AKT3)
   04152 AMPK signaling pathway
    113262966 (AKT3)
   04150 mTOR signaling pathway
    113262966 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113262966 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    113262966 (AKT3)
   04218 Cellular senescence
    113262966 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113262966 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    113262966 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113262966 (AKT3)
   04620 Toll-like receptor signaling pathway
    113262966 (AKT3)
   04625 C-type lectin receptor signaling pathway
    113262966 (AKT3)
   04660 T cell receptor signaling pathway
    113262966 (AKT3)
   04662 B cell receptor signaling pathway
    113262966 (AKT3)
   04664 Fc epsilon RI signaling pathway
    113262966 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    113262966 (AKT3)
   04062 Chemokine signaling pathway
    113262966 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113262966 (AKT3)
   04922 Glucagon signaling pathway
    113262966 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    113262966 (AKT3)
   04920 Adipocytokine signaling pathway
    113262966 (AKT3)
   04929 GnRH secretion
    113262966 (AKT3)
   04915 Estrogen signaling pathway
    113262966 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    113262966 (AKT3)
   04917 Prolactin signaling pathway
    113262966 (AKT3)
   04926 Relaxin signaling pathway
    113262966 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    113262966 (AKT3)
   04919 Thyroid hormone signaling pathway
    113262966 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113262966 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    113262966 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    113262966 (AKT3)
   04728 Dopaminergic synapse
    113262966 (AKT3)
   04722 Neurotrophin signaling pathway
    113262966 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113262966 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    113262966 (AKT3)
   04213 Longevity regulating pathway - multiple species
    113262966 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113262966 (AKT3)
   05205 Proteoglycans in cancer
    113262966 (AKT3)
   05230 Central carbon metabolism in cancer
    113262966 (AKT3)
   05231 Choline metabolism in cancer
    113262966 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113262966 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113262966 (AKT3)
   05212 Pancreatic cancer
    113262966 (AKT3)
   05225 Hepatocellular carcinoma
    113262966 (AKT3)
   05226 Gastric cancer
    113262966 (AKT3)
   05214 Glioma
    113262966 (AKT3)
   05221 Acute myeloid leukemia
    113262966 (AKT3)
   05220 Chronic myeloid leukemia
    113262966 (AKT3)
   05218 Melanoma
    113262966 (AKT3)
   05211 Renal cell carcinoma
    113262966 (AKT3)
   05215 Prostate cancer
    113262966 (AKT3)
   05213 Endometrial cancer
    113262966 (AKT3)
   05224 Breast cancer
    113262966 (AKT3)
   05222 Small cell lung cancer
    113262966 (AKT3)
   05223 Non-small cell lung cancer
    113262966 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113262966 (AKT3)
   05017 Spinocerebellar ataxia
    113262966 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113262966 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113262966 (AKT3)
   04931 Insulin resistance
    113262966 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113262966 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113262966 (AKT3)
   05135 Yersinia infection
    113262966 (AKT3)
   05152 Tuberculosis
    113262966 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113262966 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    113262966 (AKT3)
   05162 Measles
    113262966 (AKT3)
   05164 Influenza A
    113262966 (AKT3)
   05161 Hepatitis B
    113262966 (AKT3)
   05160 Hepatitis C
    113262966 (AKT3)
   05168 Herpes simplex virus 1 infection
    113262966 (AKT3)
   05163 Human cytomegalovirus infection
    113262966 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113262966 (AKT3)
   05169 Epstein-Barr virus infection
    113262966 (AKT3)
   05165 Human papillomavirus infection
    113262966 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113262966 (AKT3)
   05142 Chagas disease (American trypanosomiasis)
    113262966 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113262966 (AKT3)
   01524 Platinum drug resistance
    113262966 (AKT3)
   01522 Endocrine resistance
    113262966 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113262966 (AKT3)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113262966 (AKT3)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   113262966 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 113262966
NCBI-ProteinID: XP_026365364
UniProt: A0A3Q7XG03
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccgtcgtgaaagaaggctgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacgtttcatgtagatactccagaggaaagggaagagtggacagaa
gctattcaggctgtagcagacagacttcagagacaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggggaggaagagatggatgcttccacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactgctaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtgggaaatactatgctatgaagattctgaag
aaagaagttattattgcaaaggatgaagtggcgcatactctaacggaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgtaaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaatcacagactttgggctttgcaaagaagggatcacggacgcg
gccaccatgaagacgttctgtggcacaccggagtacctggcacccgaggtgttagaagac
aacgactatggccgagccgtggattggtggggcctgggggtcgtcatgtatgagatgatg
tgtgggaggctacctttctacaaccaggatcatgagaaactttttgaactaatactaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcactgctttcagggctc
ttgataaaggatccaaataagcgccttggcgggggcccagatgatgcaaaagaaattatg
aggcacagtttcttctctggagtcaactggcaagatgtatacgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccagatattttgatgaagaatttaca
gctcagactattacaataacgccacctgaaaaatatgacgaggacggcatggactgcgtg
gacaacgagcggcggccacacttccctcagttctcctactctgccagcggccgcgagtaa

KEGG   Ursus arctos horribilis: 113267192
Entry
113267192         CDS       T05909                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04261  Adrenergic signaling in cardiomyocytes
uah04370  VEGF signaling pathway
uah04371  Apelin signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04728  Dopaminergic synapse
uah04910  Insulin signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04920  Adipocytokine signaling pathway
uah04922  Glucagon signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04973  Carbohydrate digestion and absorption
uah05010  Alzheimer disease
uah05017  Spinocerebellar ataxia
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113267192 (AKT1)
   04015 Rap1 signaling pathway
    113267192 (AKT1)
   04010 MAPK signaling pathway
    113267192 (AKT1)
   04012 ErbB signaling pathway
    113267192 (AKT1)
   04370 VEGF signaling pathway
    113267192 (AKT1)
   04371 Apelin signaling pathway
    113267192 (AKT1)
   04630 Jak-STAT signaling pathway
    113267192 (AKT1)
   04668 TNF signaling pathway
    113267192 (AKT1)
   04066 HIF-1 signaling pathway
    113267192 (AKT1)
   04068 FoxO signaling pathway
    113267192 (AKT1)
   04072 Phospholipase D signaling pathway
    113267192 (AKT1)
   04071 Sphingolipid signaling pathway
    113267192 (AKT1)
   04024 cAMP signaling pathway
    113267192 (AKT1)
   04022 cGMP-PKG signaling pathway
    113267192 (AKT1)
   04151 PI3K-Akt signaling pathway
    113267192 (AKT1)
   04152 AMPK signaling pathway
    113267192 (AKT1)
   04150 mTOR signaling pathway
    113267192 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113267192 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    113267192 (AKT1)
   04218 Cellular senescence
    113267192 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113267192 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    113267192 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113267192 (AKT1)
   04620 Toll-like receptor signaling pathway
    113267192 (AKT1)
   04625 C-type lectin receptor signaling pathway
    113267192 (AKT1)
   04660 T cell receptor signaling pathway
    113267192 (AKT1)
   04662 B cell receptor signaling pathway
    113267192 (AKT1)
   04664 Fc epsilon RI signaling pathway
    113267192 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    113267192 (AKT1)
   04062 Chemokine signaling pathway
    113267192 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113267192 (AKT1)
   04922 Glucagon signaling pathway
    113267192 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    113267192 (AKT1)
   04920 Adipocytokine signaling pathway
    113267192 (AKT1)
   04929 GnRH secretion
    113267192 (AKT1)
   04915 Estrogen signaling pathway
    113267192 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    113267192 (AKT1)
   04917 Prolactin signaling pathway
    113267192 (AKT1)
   04926 Relaxin signaling pathway
    113267192 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    113267192 (AKT1)
   04919 Thyroid hormone signaling pathway
    113267192 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113267192 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    113267192 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    113267192 (AKT1)
   04728 Dopaminergic synapse
    113267192 (AKT1)
   04722 Neurotrophin signaling pathway
    113267192 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113267192 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    113267192 (AKT1)
   04213 Longevity regulating pathway - multiple species
    113267192 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113267192 (AKT1)
   05205 Proteoglycans in cancer
    113267192 (AKT1)
   05230 Central carbon metabolism in cancer
    113267192 (AKT1)
   05231 Choline metabolism in cancer
    113267192 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113267192 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113267192 (AKT1)
   05212 Pancreatic cancer
    113267192 (AKT1)
   05225 Hepatocellular carcinoma
    113267192 (AKT1)
   05226 Gastric cancer
    113267192 (AKT1)
   05214 Glioma
    113267192 (AKT1)
   05221 Acute myeloid leukemia
    113267192 (AKT1)
   05220 Chronic myeloid leukemia
    113267192 (AKT1)
   05218 Melanoma
    113267192 (AKT1)
   05211 Renal cell carcinoma
    113267192 (AKT1)
   05215 Prostate cancer
    113267192 (AKT1)
   05213 Endometrial cancer
    113267192 (AKT1)
   05224 Breast cancer
    113267192 (AKT1)
   05222 Small cell lung cancer
    113267192 (AKT1)
   05223 Non-small cell lung cancer
    113267192 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113267192 (AKT1)
   05017 Spinocerebellar ataxia
    113267192 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113267192 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113267192 (AKT1)
   04931 Insulin resistance
    113267192 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113267192 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113267192 (AKT1)
   05135 Yersinia infection
    113267192 (AKT1)
   05152 Tuberculosis
    113267192 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113267192 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    113267192 (AKT1)
   05162 Measles
    113267192 (AKT1)
   05164 Influenza A
    113267192 (AKT1)
   05161 Hepatitis B
    113267192 (AKT1)
   05160 Hepatitis C
    113267192 (AKT1)
   05168 Herpes simplex virus 1 infection
    113267192 (AKT1)
   05163 Human cytomegalovirus infection
    113267192 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113267192 (AKT1)
   05169 Epstein-Barr virus infection
    113267192 (AKT1)
   05165 Human papillomavirus infection
    113267192 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113267192 (AKT1)
   05142 Chagas disease (American trypanosomiasis)
    113267192 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113267192 (AKT1)
   01524 Platinum drug resistance
    113267192 (AKT1)
   01522 Endocrine resistance
    113267192 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113267192 (AKT1)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113267192 (AKT1)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   113267192 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 113267192
NCBI-ProteinID: XP_026370955
UniProt: A0A3Q7X157
LinkDB
Position
Unknown
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLFEL
ILMEELRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSDDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQGDNMEGEDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggctggctgcacaagagaggggagtacatcaaa
acctggcggccccgctacttcctcctcaagaatgacggcaccttcatcggctacaaggag
cggccccaggatgtcgagcagcgagagtcccctctcaacaacttctctgtggctcaatgt
cagctgatgaagacggagcggccccggcccaacaccttcatcatccgctgcctgcagtgg
accacggtgatcgagcgcaccttccacgtggagacacccgaggagcgggaggagtggaca
actgccatccagacggtggctgacgggctcaagaggcaggaggaagagatgatggacttc
cggtcgggctcaccgagcgacaactccggcgccgaggagatggaggtgtccctggccaag
cccaagcaccgtgtgaccatgaacgagtttgagtacttgaagctgctgggcaagggcacg
tttgggaaggtgattctggtgaaggagaaggccacgggccgctactacgccatgaagatc
ctgaagaaggaggtcattgtggccaaggacgaggttgcccacacgctcacggagaaccgt
gttctgcagaactcgaggcatcccttcctgacggccctgaagtactcctttcagacccac
gaccgcctctgcttcgtcatggagtacgccaacgggggtgagctcttcttccacctgtcc
cgggagcgcgtgttccctgaggaccgggcccgcttctacggtgccgagatcgtgtctgcc
ttggactacctgcactcggagaagaacgtggtttaccgcgacctcaagctggagaacctc
atgctggataaggacgggcacatcaagatcacggactttggcctgtgcaaggagggcatc
aaggacggggccaccatgaagaccttctgcgggacgcccgagtacctggcccccgaggtg
ctggaggacaatgactacggccgggcggtggactggtgggggctgggcgtggtcatgtac
gagatgctgtgtggccggctgcccttctacaaccaggaccacgagaagctcttcgaactc
atcctcatggaggagctccgcttcccgcgcacgctcagccctgaggccaagtccctgctc
tcggggctgctcaagaaggaccccaagcagaggctcggagggggctcagacgacgccaag
gagatcatgcagcaccgcttcttcgctagcatcgtgtggcaggacgtgtacgagaagaag
ctcagtccacccttcaagccccaggtcacatcagagacagacaccaggtattttgatgag
gagttcacggctcagatgatcaccatcacgccacctgaccaaggtgacaacatggagggt
gaggacagcgagcggaggccccacttcccgcagttctcttactcggccagcggcacagcc
tga

DBGET integrated database retrieval system