KEGG   Ursus arctos horribilis: 113243600
Entry
113243600         CDS       T05909                                 

Gene name
NFKBIB
Definition
(RefSeq) NF-kappa-B inhibitor beta isoform X1
  KO
K02581  NF-kappa-B inhibitor beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04062  Chemokine signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04722  Neurotrophin signaling pathway
uah04920  Adipocytokine signaling pathway
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05162  Measles
uah05164  Influenza A
uah05169  Epstein-Barr virus infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113243600 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    113243600 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    113243600 (NFKBIB)
   04660 T cell receptor signaling pathway
    113243600 (NFKBIB)
   04658 Th1 and Th2 cell differentiation
    113243600 (NFKBIB)
   04659 Th17 cell differentiation
    113243600 (NFKBIB)
   04662 B cell receptor signaling pathway
    113243600 (NFKBIB)
   04062 Chemokine signaling pathway
    113243600 (NFKBIB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113243600 (NFKBIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113243600 (NFKBIB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113243600 (NFKBIB)
  09172 Infectious disease: viral
   05162 Measles
    113243600 (NFKBIB)
   05164 Influenza A
    113243600 (NFKBIB)
   05169 Epstein-Barr virus infection
    113243600 (NFKBIB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243600 (NFKBIB)
   05140 Leishmaniasis
    113243600 (NFKBIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113243600 (NFKBIB)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    113243600 (NFKBIB)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_5 Ank_4
Other DBs
NCBI-GeneID: 113243600
NCBI-ProteinID: XP_026338144
UniProt: A0A3Q7V5I6
LinkDB
Position
Unknown
AA seq 354 aa
MAGVACLGKASEADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFAAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGL
HVAERGGHTALHLACRTRAHACARVLLQPRPRCARGAPNTYLAQGPDRTSDADHPSVALY
PEPDSEKEDEESEEDWKLQLEAENYEGHTPLHVAVIHKDAEMVRLLREAGADLNKPEPTC
GRSPLHLAVEAQAADVLELLLRAGADPAARMYGGRTPLGSATLRPNPILARLLRAYGAPE
PEDEDDRPGPCSSSSDSDSGDEGDEYDDIVVHSGRSQNRLPPTPASKPLPDDPV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggccggggtcgcgtgcttggggaaagcttcggaggccgatgaatggtgcgacagcggc
ctgggctctctgggtccggacgcagcagcccccggaggaccggggttgggcgccgagctg
ggcccggggctgtcgtgggcgcccctcgtctttggctacgtcactgaggatggggacacg
gcactgcacttggcagtgattcatcagcacgagcccttcctggatttcctcctgggcttt
gcggcgggcaccgaatacctggacctgcagaatgacctgggccagacagcccttcacctg
gcagccatcctgggggaggcctccacagtggagaagttgtacgcggcgggtgccgggttg
catgtggcggagcgtgggggccacacagcgctgcacctggcctgccgcacgagggcacac
gcctgcgctcgtgtgctactccagccccgtccccggtgcgccaggggagcccccaacacc
tacctcgctcagggccctgaccgcacctctgacgccgaccacccgtctgttgccttgtac
cccgaacctgactcggagaaggaagatgaagagagtgaggaggattggaagctgcagctg
gaggctgaaaactacgagggccataccccacttcacgtggccgtcatccacaaagatgca
gagatggtccggctgctccgggaggctggagcggacctcaacaaaccggagcccacgtgt
ggccggagccccctgcacttggcagtggaggcccaagccgccgatgtgctggagctcctc
ctgagggcaggtgccgaccctgccgcccgcatgtatgggggccgcaccccactgggcagt
gccacgctccggcccaaccccatccttgcccgccttctccgtgcatatggagcccctgag
cccgaggacgaggacgacaggcctggcccctgcagcagcagtagcgacagtgacagcggg
gacgagggcgatgaatacgacgacatcgtggtccacagtggccggagccaaaaccggcta
cctcccaccccagcctcaaaacctctccctgatgaccccgtctga

KEGG   Ursus arctos horribilis: 113266131
Entry
113266131         CDS       T05909                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
uah04210  Apoptosis
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04920  Adipocytokine signaling pathway
uah04926  Relaxin signaling pathway
uah04931  Insulin resistance
uah05132  Salmonella infection
uah05134  Legionellosis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05215  Prostate cancer
uah05220  Chronic myeloid leukemia
uah05222  Small cell lung cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113266131 (NFKBIA)
   04668 TNF signaling pathway
    113266131 (NFKBIA)
   04024 cAMP signaling pathway
    113266131 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113266131 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113266131 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    113266131 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    113266131 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    113266131 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    113266131 (NFKBIA)
   04660 T cell receptor signaling pathway
    113266131 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    113266131 (NFKBIA)
   04659 Th17 cell differentiation
    113266131 (NFKBIA)
   04657 IL-17 signaling pathway
    113266131 (NFKBIA)
   04662 B cell receptor signaling pathway
    113266131 (NFKBIA)
   04062 Chemokine signaling pathway
    113266131 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113266131 (NFKBIA)
   04926 Relaxin signaling pathway
    113266131 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113266131 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113266131 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113266131 (NFKBIA)
   05203 Viral carcinogenesis
    113266131 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113266131 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    113266131 (NFKBIA)
   05215 Prostate cancer
    113266131 (NFKBIA)
   05222 Small cell lung cancer
    113266131 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    113266131 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113266131 (NFKBIA)
   05135 Yersinia infection
    113266131 (NFKBIA)
   05134 Legionellosis
    113266131 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113266131 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    113266131 (NFKBIA)
   05162 Measles
    113266131 (NFKBIA)
   05164 Influenza A
    113266131 (NFKBIA)
   05161 Hepatitis B
    113266131 (NFKBIA)
   05160 Hepatitis C
    113266131 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    113266131 (NFKBIA)
   05163 Human cytomegalovirus infection
    113266131 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113266131 (NFKBIA)
   05169 Epstein-Barr virus infection
    113266131 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113266131 (NFKBIA)
   05140 Leishmaniasis
    113266131 (NFKBIA)
   05142 Chagas disease (American trypanosomiasis)
    113266131 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113266131 (NFKBIA)
   04131 Membrane trafficking [BR:uah04131]
    113266131 (NFKBIA)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    113266131 (NFKBIA)
Membrane trafficking [BR:uah04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    113266131 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 113266131
NCBI-ProteinID: XP_026369388
UniProt: A0A3Q7X522
LinkDB
Position
Unknown
AA seq 314 aa
MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEDYEQLVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttccagcctgccgagcacgcccaggactgggccatggagggtccgcgggacgcgctc
aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gactacgagcagttggtgaaggagctgcgggagatccgcctcgagccgcaggaggcgccg
cggggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggcactgaccatggaagtgatccgccaagtgaagggcgac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccaaccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctcgccagtgtg
ggagtcctgactcagacctgcaggacccagcacctctactccatcctccaggccaccaac
tacaatggtcacacgtgtctacatttggcctctatccatggttacttgggcatcgtggag
cttttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggtcgaacagcc
ctccatcttgcagtggacctgcagaattctgacctcgtgtcactcttgttgaagtgcggg
gctgacgtcaaccgagtcacctaccagggctactccccataccagctcacctggggccgc
ccaagcacgcggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg
ccggagagtgaggatgaggagagctacgacacggagtcagagttcacggaagacgagcta
ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system