KEGG   Ursus arctos horribilis: 113243662Help
Entry
113243662         CDS       T05909                                 

Gene name
LTA
Definition
(RefSeq) lymphotoxin-alpha
  KO
K05468  lymphotoxin alpha (TNF superfamily, member 1)
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04064  NF-kappa B signaling pathway
uah04668  TNF signaling pathway
uah04940  Type I diabetes mellitus
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113243662 (LTA)
   04668 TNF signaling pathway
    113243662 (LTA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113243662 (LTA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113243662 (LTA)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243662 (LTA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243662 (LTA)
   05168 Herpes simplex virus 1 infection
    113243662 (LTA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243662 (LTA)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Tumor necrosis fators
   113243662 (LTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 113243662
NCBI-ProteinID: XP_026338223
UniProt: A0A3Q7UQ22
LinkDB All DBs
Position
Unknown
AA seq 204 aa AA seqDB search
MTPPGRLYLLRVCSAPPLLLLGLLLALPPEAQGLPGVGVSPSAARTAYQHPQKHFAPGTL
KPAAHLIGDPSTQSSLRWRANTDRAFLRHGFSLSNNSLLVPTSGLYFVYSQVVFSGEGCF
PKATPTPLYLAHEVQLFSSQYPFHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTQGDQL
STHTDGVSHLLLSPSSVFFGAFAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacacctcctggacggctctacctcctgagggtgtgcagcgccccccccctcctcctc
ctggggctgctgctggccctgccgcctgaggcccaggggcttcctggggtcggcgtctca
ccctcagctgcccggactgcctaccagcaccctcagaagcacttcgcaccaggcaccctc
aaaccagctgctcatcttattggagaccccagcacccagagctcactgcgctggagagca
aacacggatcgtgccttcctccgacatggcttctctttgagcaacaattccctcctggtt
cccaccagtggcctctactttgtctactcccaggtggtcttctctggagaaggctgcttc
cccaaggccacccccacccctctctacctggcccatgaggtccagctcttctcctcccag
taccccttccacgtgcctctcctcagtgctcagaagtctgtgtgcccagggccacaggga
ccttgggtgcgctctgtgtaccagggagcggtgttcctgctcacccagggagatcagctc
tccactcacacggatggtgtctcccacctactcctcagccccagtagtgtcttctttgga
gcctttgctctgtag

DBGET integrated database retrieval system