KEGG   Ursus arctos horribilis: 113243684
Entry
113243684         CDS       T05909                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DP alpha 1 chain-like
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243684
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243684
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243684
   04612 Antigen processing and presentation
    113243684
   04658 Th1 and Th2 cell differentiation
    113243684
   04659 Th17 cell differentiation
    113243684
   04672 Intestinal immune network for IgA production
    113243684
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243684
   05322 Systemic lupus erythematosus
    113243684
   05323 Rheumatoid arthritis
    113243684
   05320 Autoimmune thyroid disease
    113243684
   05321 Inflammatory bowel disease (IBD)
    113243684
   05330 Allograft rejection
    113243684
   05332 Graft-versus-host disease
    113243684
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243684
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243684
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243684
   05152 Tuberculosis
    113243684
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243684
   05164 Influenza A
    113243684
   05168 Herpes simplex virus 1 infection
    113243684
   05169 Epstein-Barr virus infection
    113243684
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243684
   05140 Leishmaniasis
    113243684
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243684
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243684
  Exosomal proteins of epithelial cells
   113243684
  Exosomal proteins of breast milk
   113243684
SSDB
Motif
Pfam: MHC_II_alpha C1-set
Other DBs
NCBI-GeneID: 113243684
NCBI-ProteinID: XP_026338240
UniProt: A0A3Q7UDE8
LinkDB
Position
Unknown
AA seq 272 aa
MSRTQVVILGAITLAALLSPHGTEAIRGDHVSVYAEFVQTRRPSGEYMFEFDGDEQFYVD
LDKKETVWQLPEFIHAFDFDAWRRVADIVTAKKNLNILIQRSTHQGHKWQQTYQVLSLPK
EPVELGQPNTLIXHVDKFFPPVLNVTWLCNGQIVTKGITETVFLPTTEFRFHKFHYLTFL
PTAEDVYDCKVKHWGLDQLLLXHWGAQELIQVPETKETVVCVLGLVAGVAGILTGIVVLK
TRRPDSIPRCRGSCESSQCWYQGHSAKEEAAR
NT seq 819 nt   +upstreamnt  +downstreamnt
atgagccggacccaagtcgtgatcttgggagccatcaccctggctgccctgctgagtccc
catggaactgaggccatcaggggtgaccacgtgtcagtgtatgccgagtttgtccagaca
cgcagaccctctggggagtacatgtttgaatttgatggggatgagcagttttatgtggac
ctggataagaaggagactgtctggcaactgccagagtttattcatgccttcgactttgat
gcttggaggcgtgttgctgacattgtcacagcaaagaagaacttgaacatcctgatccaa
cgatccacacaccagggccacaaatggcagcagacttaccaggtcctgtcccttccaaag
gagcctgtggagctgggacagcccaacaccctaatctgacatgtggacaagtttttccca
cctgtgctcaatgtcacatggctgtgcaatgggcaaattgtcaccaaaggaataactgag
actgttttcctgcccaccacagaattcagattccacaagttccactacctaaccttcctt
cccacggctgaagatgtctatgactgcaaggtgaagcactggggcctggaccagctgctc
ctttagcactggggggctcaggagctgatccaagtgcctgagacgaaagagactgtggtc
tgtgtcctgggcctggtggcaggtgtggcgggcatcctcactggcatcgttgtcctgaag
accaggcgacccgacagcatccccaggtgcaggggctcctgtgagtcatcccagtgctgg
taccagggacacagtgcaaaagaggaggcagcccggtag

KEGG   Ursus arctos horribilis: 113243685
Entry
113243685         CDS       T05909                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DP beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243685
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243685
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243685
   04612 Antigen processing and presentation
    113243685
   04658 Th1 and Th2 cell differentiation
    113243685
   04659 Th17 cell differentiation
    113243685
   04672 Intestinal immune network for IgA production
    113243685
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243685
   05322 Systemic lupus erythematosus
    113243685
   05323 Rheumatoid arthritis
    113243685
   05320 Autoimmune thyroid disease
    113243685
   05321 Inflammatory bowel disease (IBD)
    113243685
   05330 Allograft rejection
    113243685
   05332 Graft-versus-host disease
    113243685
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243685
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243685
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243685
   05152 Tuberculosis
    113243685
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243685
   05164 Influenza A
    113243685
   05168 Herpes simplex virus 1 infection
    113243685
   05169 Epstein-Barr virus infection
    113243685
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243685
   05140 Leishmaniasis
    113243685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243685
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243685
  Exosomal proteins of epithelial cells
   113243685
  Exosomal proteins of breast milk
   113243685
SSDB
Motif
Pfam: C1-set Ig_3
Other DBs
NCBI-GeneID: 113243685
NCBI-ProteinID: XP_026338241
UniProt: A0A3Q7TQ66
LinkDB
Position
Unknown
AA seq 159 aa
MDSVCKHNFDLDEGFTLKRRVQPKVNVSPSEKGHPQHHNLLVCHVSDFYPGHIQVHXFLN
GQEETAGVLSANSMHNGDWTFQILVMLEMTPQQGDVYVCQVEHPSLDSPVTVEWKAQSDS
AQSKMLAGLGGFALGLTALGASFILRFRSQRGKKLLESG
NT seq 480 nt   +upstreamnt  +downstreamnt
atggactccgtgtgcaagcacaacttcgacttggacgagggtttcacgctgaagcgcaga
gtccagcctaaagtgaacgtctccccctccgagaaggggcacccgcagcaccacaacctg
cttgtttgccacgtgtcagatttctacccaggccacattcaagtccactgattcttgaat
ggacaggaggaaacagctggggttttatccgccaactcgatgcacaatggagactggacc
ttccagatcctggtgatgctggaaatgaccccccagcagggagacgtctacgtctgccaa
gtggagcatcccagcctggacagtcctgtcaccgtggagtggaaggcacagtctgattct
gcccagagcaagatgctggctggactcggaggctttgcgctagggctcaccgccctcgga
gcgagcttcattcttcgttttagaagccagcgaggtaagaaacttctggaaagtggttga

KEGG   Ursus arctos horribilis: 113243704
Entry
113243704         CDS       T05909                                 

Definition
(RefSeq) DLA class I histocompatibility antigen, A9/A9 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243704
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113243704
   04145 Phagosome
    113243704
  09143 Cell growth and death
   04218 Cellular senescence
    113243704
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113243704
   04612 Antigen processing and presentation
    113243704
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113243704
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113243704
   05330 Allograft rejection
    113243704
   05332 Graft-versus-host disease
    113243704
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243704
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243704
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243704
   05170 Human immunodeficiency virus 1 infection
    113243704
   05168 Herpes simplex virus 1 infection
    113243704
   05163 Human cytomegalovirus infection
    113243704
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243704
   05169 Epstein-Barr virus infection
    113243704
   05165 Human papillomavirus infection
    113243704
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243704
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113243704
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113243704
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113243704
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig Ig_2 MATalpha_HMGbox EphA2_TM
Other DBs
NCBI-GeneID: 113243704
NCBI-ProteinID: XP_026338255
UniProt: A0A3Q7UDG5
LinkDB
Position
Unknown
AA seq 418 aa
MSSCLETPDAACFAFPLGVGLLEKPISGSPVSDYKVFAPAPGPSGYSESTETPDMQILLR
RSLVLLLSGALAMTETWAGSHSLRYFHTAVFRPGRGEPRFISVGYVDDTQFVRFDSDSAS
RRAEPRAPWMEQEGPEYWDRETRNAKDNAQTFRLDLNNLRGYYNQSEAGSHTIQWMYGCD
VGPDGRLLRGYEQFAYDGADYIALNEDLRSWTAADTAAQITRSRWEAAGDAEHDRNYVEC
TCVEWLRRYLENGKETLQRAETPNTHVTRHPISDQRVTLRCWALGFYPAEITLTWHHDGE
DLTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPPPQPTI
TVPITWIIAGLVLLTVTVAIGAVIWRRKRSGGKGPSYSHAARDDSAQGSDVSLTVPKV
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtcctcctgcctggagactcctgacgcagcctgcttcgcattcccattgggtgtcggg
cttctggagaagccaatcagcggctccccggtttccgattataaagtcttcgcacccgcc
ccagggccaagcggctactcagagtctaccgagaccccggacatgcagatcctgctgcgc
cgatccctcgtcctgctactgtcgggggctctggccatgaccgagacctgggcgggctcg
cactccctgaggtatttccacaccgcggtgttccggcccggccgcggggagccccgcttc
atctctgtcggctacgtggacgacacgcagttcgtgcggttcgacagcgactctgccagt
cggagggccgagccgcgggcgccgtggatggagcaggaggggcccgagtattgggaccgg
gagacgcggaatgccaaggacaacgcgcagactttccgactggacctgaacaacctgcgg
ggctactacaaccagagcgaggccggctctcacaccatccagtggatgtacggctgcgac
gtgggacccgacgggcgcctcctccgcggttatgagcagttcgcctacgacggcgcggat
tacatcgccctgaacgaggacctgcgctcctggaccgcggcggacacggcggctcagatc
acccggagcaggtgggaggcggcaggtgatgcagagcacgacaggaactacgtggagtgc
acctgcgtggagtggctccgcaggtacctggagaacgggaaggagacactgcaacgtgca
gaaacccccaacacacatgtgacccgccatcccatctccgaccaaagggtcaccctgagg
tgctgggccctgggcttctaccctgcggagatcaccctgacctggcaccacgatggggag
gacctgacccaggacacagagcttgtggagaccaggcctgcaggagatgggaccttccag
aagtgggcagctgtggtggtgccttctggagaggagcagagatacacgtgccatgtgcag
catgaggggctgcccgagcccctcacactgagatgggagccacctcctcagcccaccatc
accgtccccatcacgtggatcatcgctggtctggttctccttacagtcactgtggcgatt
ggagctgtgatctggaggaggaagcgctcaggaggaaaaggaccgagttactctcacgct
gcacgcgatgacagtgcccagggctctgatgtgtctcttacggttcctaaagtgtga

KEGG   Ursus arctos horribilis: 113243706
Entry
113243706         CDS       T05909                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, alpha chain G-like isoform X1
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243706
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113243706
   04145 Phagosome
    113243706
  09143 Cell growth and death
   04218 Cellular senescence
    113243706
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113243706
   04612 Antigen processing and presentation
    113243706
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113243706
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113243706
   05330 Allograft rejection
    113243706
   05332 Graft-versus-host disease
    113243706
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243706
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243706
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243706
   05170 Human immunodeficiency virus 1 infection
    113243706
   05168 Herpes simplex virus 1 infection
    113243706
   05163 Human cytomegalovirus infection
    113243706
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243706
   05169 Epstein-Barr virus infection
    113243706
   05165 Human papillomavirus infection
    113243706
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243706
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113243706
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113243706
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113243706
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2 ig
Other DBs
NCBI-GeneID: 113243706
NCBI-ProteinID: XP_026338257
UniProt: A0A3Q7VJW9
LinkDB
Position
Unknown
AA seq 383 aa
MRVVMPRTLLLLLSGALAVTETWEGSHSLRYFGTSVSRPGRGEPRYVEVGYVDDTQFARF
DSDSASRRMEPRAPWVEQEGPEFWDQETRGAKDTAQTFRGDLQTLRGYYNQSEAGSHTIQ
WTSACDVGLDWRLLRGYWQLAYDGADYIALNEDLRSWTAADTAAQITRRKWEVAGAAEQQ
RNELEVTCVEWLRRYLEMGNKTLLRTGAEALQPPRSVNLVAASCPCRSSRGGACCWDSQV
DFALVELDLPCRLCAQHPPKTHVTYHPLTDHEVTLRCWALGFSPAEITLTWHHDGEDLTQ
DTELVEPRPAGDGTFQKWAAVVVPSGEEQRYTCRVQHGGLPEPLTLRWESPPRPLIPVVG
IMAGLVVVVVTGAVLVGAVMWRK
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgcgagtcgtaatgccccgaaccctcctcctgctgctgtcaggggccctggcggtgacc
gagacctgggagggctcccactccctgaggtatttcggcacctccgtgtcccggcccggc
cgcggggagccccggtacgtggaagtcggctacgtggacgacacgcagttcgcgcggttc
gacagcgactctgccagtcggaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagttttgggaccaggagacgcggggcgccaaggacaccgcacagactttccgaggg
gacctgcagacactgcggggctactacaaccagagcgaggccgggtctcacaccatccag
tggacgtctgcttgcgacgtggggctggactggcgcctcctccgcgggtactggcagttg
gcctacgacggcgccgattacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacacggcggcgcagatcacccggcgcaagtgggaggtggccggtgcagcggagcagcag
aggaacgagctggaggtcacgtgcgtggaatggctccggaggtacctggagatggggaat
aagacgctgctgcgcacaggggccgaagctttgcagcccccaaggtcagttaacttggtg
gcagcgagttgtccctgccggtcttctaggggcggggcctgttgctgggattctcaggtg
gactttgctctggtagaactggacctcccttgcagactctgcgctcagcatcccccgaag
acacatgtcacctaccatcccctcactgaccatgaggtcaccctgaggtgctgggccctg
ggcttctcccctgcggagatcaccctgacctggcaccacgatggggaggacctgacccag
gatacagagcttgtggagccgaggcctgcaggggatgggaccttccagaagtgggcggct
gtggtggtgccttctggagaggagcagagatacacgtgccgtgtgcagcatggggggctg
cctgagcccctcacactgagatgggagtcccctcctcggcccctcattcccgtcgtgggc
atcatggctggtctggttgtggttgtggtcactggcgctgtgctggttggagctgtcatg
tggaggaaatag

KEGG   Ursus arctos horribilis: 113243774
Entry
113243774         CDS       T05909                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243774
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243774
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243774
   04612 Antigen processing and presentation
    113243774
   04658 Th1 and Th2 cell differentiation
    113243774
   04659 Th17 cell differentiation
    113243774
   04672 Intestinal immune network for IgA production
    113243774
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243774
   05322 Systemic lupus erythematosus
    113243774
   05323 Rheumatoid arthritis
    113243774
   05320 Autoimmune thyroid disease
    113243774
   05321 Inflammatory bowel disease (IBD)
    113243774
   05330 Allograft rejection
    113243774
   05332 Graft-versus-host disease
    113243774
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243774
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243774
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243774
   05152 Tuberculosis
    113243774
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243774
   05164 Influenza A
    113243774
   05168 Herpes simplex virus 1 infection
    113243774
   05169 Epstein-Barr virus infection
    113243774
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243774
   05140 Leishmaniasis
    113243774
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243774
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243774
  Exosomal proteins of epithelial cells
   113243774
  Exosomal proteins of breast milk
   113243774
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2
Other DBs
NCBI-GeneID: 113243774
NCBI-ProteinID: XP_026338393
UniProt: A0A3Q7UQI3
LinkDB
Position
Unknown
AA seq 254 aa
MAISGVPVLGFFIMALLMGPQESRAIKEDHVIIQAEFYMTPDPSGEFMFDFDGDEIFHVD
LEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDIMIKRSNHTPNTNVPPEVTVLSNT
PVELGEPNTLICFIDKFSPPVINVTWLRNGNPVTTGVSETVFLPREDHLFRKFHYLPFLP
SADDVYDCKVEHWGLDKPLLKHWEFEAPTPFPETTENVVCALGLVVGLVGIIVGTVFIIK
GMRKVNAGERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccataagtggagtcccagtgctaggatttttcatcatggctttactgatgggtccc
caggaatcacgggctatcaaagaggaccatgtgatcatccaggctgagttctatatgacc
cctgacccgtcaggcgagtttatgtttgacttcgatggtgatgagattttccatgtggat
ttggaaaagaaggagacggtgtggcggctggaagaatttggacgttttgccagttttgag
gcccagggtgccttggccaacatagctgtggacaaagctaacctggacatcatgataaag
cgctccaaccacaccccaaacaccaatgtacctccagaggtgactgtgctctcaaacacc
cctgtggaactgggagagcccaacaccctcatctgtttcatcgacaagttctccccaccg
gtgatcaatgtcacgtggcttcgaaatggaaaccctgtcaccacaggagtgtcagagaca
gtcttcctgcccagggaagaccaccttttccgcaagttccactatctccctttcctgccc
tcagccgatgatgtctatgactgcaaggtggagcactggggtttggacaagcctcttctc
aagcactgggagtttgaagcaccaactcccttcccagagacaacagagaatgtggtgtgt
gctctgggcctggttgtgggtctggtgggcatcattgttgggaccgtcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgccgagggcctctgtga

KEGG   Ursus arctos horribilis: 113243775
Entry
113243775         CDS       T05909                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243775
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243775
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243775
   04612 Antigen processing and presentation
    113243775
   04658 Th1 and Th2 cell differentiation
    113243775
   04659 Th17 cell differentiation
    113243775
   04672 Intestinal immune network for IgA production
    113243775
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243775
   05322 Systemic lupus erythematosus
    113243775
   05323 Rheumatoid arthritis
    113243775
   05320 Autoimmune thyroid disease
    113243775
   05321 Inflammatory bowel disease (IBD)
    113243775
   05330 Allograft rejection
    113243775
   05332 Graft-versus-host disease
    113243775
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243775
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243775
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243775
   05152 Tuberculosis
    113243775
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243775
   05164 Influenza A
    113243775
   05168 Herpes simplex virus 1 infection
    113243775
   05169 Epstein-Barr virus infection
    113243775
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243775
   05140 Leishmaniasis
    113243775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243775
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243775
  Exosomal proteins of epithelial cells
   113243775
  Exosomal proteins of breast milk
   113243775
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 MHC_I DUF202 C2-set_2 I-set
Other DBs
NCBI-GeneID: 113243775
NCBI-ProteinID: XP_026338394
UniProt: A0A3Q7V663
LinkDB
Position
Unknown
AA seq 266 aa
MVCLCFLGGSWMPALTLILMVLSPPLAWARDTPPHFLEQVKFECHFTNGTERVRLLVRDI
YNGQENVRFDSDVGEFRAVTELGRPDAEYWNQQKDFMEQTRAAVDTYCRHNYGVSDSFLV
RRQAEPTVTMYPTKTRPLQHHNLLVCSVNGFYPGHLEVRWFRNGQEEEAGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCQVEHPSLMNPVTVEWRARSDSAQSKMLSGIGGFVLGLL
FLVVGLFLYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgtgtttccttggaggctcctggatgccagctctgacattgatcctgatg
gtgctgagccctcccttggcttgggctagggacaccccaccacatttcttagaacaggtg
aagttcgagtgtcatttcaccaacggcacggagcgggtgcggctcctggtcagagacatc
tataacgggcaggagaacgtgcgcttcgacagcgacgtgggggagttccgggcggtgacg
gagctggggcggccggacgctgagtactggaaccagcagaaggacttcatggagcagacg
cgggccgcggtggacacgtactgcagacacaactacggggtgtcggacagcttcctggtg
cggcgacaagcggagcctacagtcaccatgtatcctacgaagacccggcccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggccaccttgaagtcaggtgg
ttccggaacggccaggaagaggaggctggggtcgtgtccacaggcctgatccgaaatgga
gactggaccttccagaccctggtgatgctggagacagttcctcagagtggagaggtctac
acctgccaagtggagcacccaagtttgatgaaccctgtcaccgtggaatggagggcacgg
tctgactctgcacagagcaagatgctgagtggaatcggaggctttgttctaggtctgctc
ttcctggtggtggggctgttcctctacttcaggaatcagaaggggcactctggacttcag
ccaacaggactcctgagctga

KEGG   Ursus arctos horribilis: 113243776
Entry
113243776         CDS       T05909                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain-like
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243776
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243776
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243776
   04612 Antigen processing and presentation
    113243776
   04658 Th1 and Th2 cell differentiation
    113243776
   04659 Th17 cell differentiation
    113243776
   04672 Intestinal immune network for IgA production
    113243776
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243776
   05322 Systemic lupus erythematosus
    113243776
   05323 Rheumatoid arthritis
    113243776
   05320 Autoimmune thyroid disease
    113243776
   05321 Inflammatory bowel disease (IBD)
    113243776
   05330 Allograft rejection
    113243776
   05332 Graft-versus-host disease
    113243776
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243776
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243776
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243776
   05152 Tuberculosis
    113243776
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243776
   05164 Influenza A
    113243776
   05168 Herpes simplex virus 1 infection
    113243776
   05169 Epstein-Barr virus infection
    113243776
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243776
   05140 Leishmaniasis
    113243776
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243776
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243776
  Exosomal proteins of epithelial cells
   113243776
  Exosomal proteins of breast milk
   113243776
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 I-set SKG6
Other DBs
NCBI-GeneID: 113243776
NCBI-ProteinID: XP_026338396
UniProt: A0A3Q7TQM5
LinkDB
Position
Unknown
AA seq 255 aa
MTLNRVLILGTLALTTMMSPSDSEDIVADHVAYYGINVYQSYGPSGQFTHEFDGDELFYV
DLEKKETVWRLPMFSTFETFDPQGALRNLAIVKQNLNIIIKRSNYTAATNEVPEVTVFPK
SPVMLGQPNTLICLVDNIFPPVINVTWLKNRHSVTEGVSETSFLAKTDHSFLKISYLTFL
PSADDIYDCKVEHWGLEEPLLKHWEPEIATPMSELTETVVCALGLAVGLVGIVVGTVFIV
QGLRSGGTPGHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaccctgaacagagttctgattctggggactcttgccctgaccaccatgatgagcccc
agtgacagtgaagacattgtggctgaccatgttgcttactacggcataaacgtctaccag
tcttatggtccctctggccagttcacccatgaatttgatggagatgagttgttctacgtg
gacctggagaagaaggaaactgtctggcggctgcctatgtttagcacatttgaaactttt
gacccacaaggtgcactgagaaacttggctatagtaaaacaaaacttgaacatcataatt
aagcgttccaactataccgctgctaccaatgaggttcctgaggtgactgtgtttcccaag
tctcctgtgatgctgggtcagcccaacaccctcatctgtcttgtggacaacatctttcct
cctgtgatcaatgtcacatggttgaagaatagacactcagtcacagaaggtgtttctgaa
accagcttcctcgcaaaaacggatcattccttcttaaagatcagttacctcaccttcctc
ccttctgctgatgatatttatgactgcaaggtggagcactggggcctggaggagccactt
ctgaaacactgggaacctgagatcgcaacccctatgtcagagctgacagagactgtggtc
tgtgccctggggttggctgtgggccttgtgggcatcgtggtgggcactgtcttcattgtc
caaggcctgcgttcaggtggtactcccggacatcaaggacctttgtga

KEGG   Ursus arctos horribilis: 113243777
Entry
113243777         CDS       T05909                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243777
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243777
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243777
   04612 Antigen processing and presentation
    113243777
   04658 Th1 and Th2 cell differentiation
    113243777
   04659 Th17 cell differentiation
    113243777
   04672 Intestinal immune network for IgA production
    113243777
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243777
   05322 Systemic lupus erythematosus
    113243777
   05323 Rheumatoid arthritis
    113243777
   05320 Autoimmune thyroid disease
    113243777
   05321 Inflammatory bowel disease (IBD)
    113243777
   05330 Allograft rejection
    113243777
   05332 Graft-versus-host disease
    113243777
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243777
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243777
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243777
   05152 Tuberculosis
    113243777
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243777
   05164 Influenza A
    113243777
   05168 Herpes simplex virus 1 infection
    113243777
   05169 Epstein-Barr virus infection
    113243777
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243777
   05140 Leishmaniasis
    113243777
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243777
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243777
  Exosomal proteins of epithelial cells
   113243777
  Exosomal proteins of breast milk
   113243777
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 113243777
NCBI-ProteinID: XP_026338397
UniProt: A0A3Q7VKA7
LinkDB
Position
Unknown
AA seq 265 aa
MAPWIPRGLWTAAVMMILVLLSIPAAEGRDSPQDFVYQFKFECYFTNGTERVRLLTRYIY
NREEFVHYDSDVGEYRPVTELGRPDAEYWNPQKDIMERTRAEVDTVCRHNYQIEDRFILQ
RRVEPTVTISPSRTEVLNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGD
WTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESARSKMLSGIGGFVLGLIF
LGLGLIIRHRSQKGPHGSPPTGLLR
NT seq 798 nt   +upstreamnt  +downstreamnt
atggctccgtggatccccagaggcctctggacagcagctgtgatgatgatcctggtgctg
ctgagcatcccagcggctgagggcagagactctccacaggatttcgtgtaccagtttaag
ttcgagtgctacttcaccaacgggacagagcgggtgcggctcctgaccagatacatctat
aaccgggaggagttcgtgcactacgacagcgacgtgggggagtaccggccggtgacggag
ctggggcggccggacgctgagtactggaacccgcagaaggacatcatggagcggacgcgg
gccgaggtggacacggtgtgcagacacaactaccagattgaggacaggttcatcctgcag
cggcgagtggaacctacagtgaccatctccccatccaggacggaggttctgaaccaccac
aatctgctggtctgctcagtgacagatttctacccaggccagatcaaagttcggtggttt
cggaatgaccaggaagagacagctggtgtcgtgtccactccacttattaggaatggggac
tggaccttccagatcctggtgatgctggaaatgactccccagcgaggagatgtctacacc
tgccatgtggagcatcccagcctccagagccccatcacggtggagtggcgggcacagtct
gaatctgcccggagcaagatgctgagtggcatcggaggctttgtgctggggctgatcttc
cttgggctgggccttatcatccgtcacaggagccagaaaggacctcatgggtctccccca
acagggctcctgcgctga

KEGG   Ursus arctos horribilis: 113243778
Entry
113243778         CDS       T05909                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243778
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243778
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243778
   04612 Antigen processing and presentation
    113243778
   04658 Th1 and Th2 cell differentiation
    113243778
   04659 Th17 cell differentiation
    113243778
   04672 Intestinal immune network for IgA production
    113243778
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243778
   05322 Systemic lupus erythematosus
    113243778
   05323 Rheumatoid arthritis
    113243778
   05320 Autoimmune thyroid disease
    113243778
   05321 Inflammatory bowel disease (IBD)
    113243778
   05330 Allograft rejection
    113243778
   05332 Graft-versus-host disease
    113243778
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243778
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243778
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243778
   05152 Tuberculosis
    113243778
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243778
   05164 Influenza A
    113243778
   05168 Herpes simplex virus 1 infection
    113243778
   05169 Epstein-Barr virus infection
    113243778
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243778
   05140 Leishmaniasis
    113243778
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243778
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243778
  Exosomal proteins of epithelial cells
   113243778
  Exosomal proteins of breast milk
   113243778
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 C2-set_2 DUF202 vMSA MHC_I
Other DBs
NCBI-GeneID: 113243778
NCBI-ProteinID: XP_026338398
UniProt: A0A3Q7UQI8
LinkDB
Position
Unknown
AA seq 266 aa
MAYLWFPRGLSMAALMVILMMLSPPLAWATDTPPHFLFLGKAECHFTNGTERVRFLDRYI
YNREEYVRFDSDVGEYRAVTELGRPDAEYWNQQKDLVEQTRAEVDTVCRHNYGVLDSFLV
QRQAEPTVTVYPTKTRPLQHHNLLVCSVNGFYPGHIEVRWFRNGQEEEAGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCQVKHPSLTSPVTVEWRARSDSAQSKMLSGIGGFVLGLL
FLVVGLFLYFRNQKGHSGLQPAGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcatatctctggttccctagaggcttatcaatggcagctctgatggtgatactgatg
atgctgagccctcccttggcttgggctacggacaccccacctcacttcttgttcctgggg
aaggccgagtgtcatttcaccaacggcacggagcgggtgcggttcctggacagatacatc
tataaccgggaggagtacgtgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggccggacgctgagtactggaaccagcagaaggacctcgtggagcagacg
cgggccgaggtggacacggtgtgcagacacaactacggggtgttggacagcttcctggtg
cagcgacaagcggagcctacagtcactgtgtatcctacgaagacccggcccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggccacattgaagtcaggtgg
ttccggaacggccaggaagaggaggctggggtcgtgtccacaggcctgatccgaaatgga
gactggaccttccagaccctggtgatgctggagacagttcctcagagtggagaggtctat
acctgccaagtgaagcacccaagtttgaccagccctgtcaccgtggaatggagggcacgg
tctgactctgcacagagcaagatgctgagtggaatcggaggctttgttctgggtctgctc
ttcctggtggtggggctgttcctctacttcaggaatcagaagggccactctggacttcag
ccagcaggactcctgagctga

KEGG   Ursus arctos horribilis: 113243779
Entry
113243779         CDS       T05909                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243779
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243779
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243779
   04612 Antigen processing and presentation
    113243779
   04658 Th1 and Th2 cell differentiation
    113243779
   04659 Th17 cell differentiation
    113243779
   04672 Intestinal immune network for IgA production
    113243779
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243779
   05322 Systemic lupus erythematosus
    113243779
   05323 Rheumatoid arthritis
    113243779
   05320 Autoimmune thyroid disease
    113243779
   05321 Inflammatory bowel disease (IBD)
    113243779
   05330 Allograft rejection
    113243779
   05332 Graft-versus-host disease
    113243779
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243779
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243779
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243779
   05152 Tuberculosis
    113243779
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243779
   05164 Influenza A
    113243779
   05168 Herpes simplex virus 1 infection
    113243779
   05169 Epstein-Barr virus infection
    113243779
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243779
   05140 Leishmaniasis
    113243779
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243779
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243779
  Exosomal proteins of epithelial cells
   113243779
  Exosomal proteins of breast milk
   113243779
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 113243779
NCBI-ProteinID: XP_026338399
UniProt: A0A3Q7V668
LinkDB
Position
Unknown
AA seq 273 aa
MGSGWFPWMVALLVSVIRLDSSMTQVRDSPEDFVIQAKADCYFINGTEKVQFVVRFIFNL
EEYARFDSCVGMFVALTELGKPDAELWNSRPDILERSRASVDALCRRNYKLGAPFTVRRK
VQPEVTVYPERIPSLQHRNLLLCSVTGFYPGDIKIRWFRNGQEERVGVMSTGLIRNGDWT
FQTMVMLEMTPELGDVYTCLVNHPSLLSPISVEWRAQSAYSWRKMLSGSATFLLGLIFFL
VGTVICLRAQKGYVQIQLSGDEVSSAVPSPQPC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggttctgggtggtttccatggatggtggctctcctagtgagtgtaatccgactggat
tcctccatgactcaagtcagagactctccagaagatttcgtgattcaggcaaaggctgac
tgttacttcatcaacgggacagagaaagtgcagtttgtggtgagattcatttttaacttg
gaggagtatgcacgtttcgacagctgtgtgggaatgtttgtggcgttgacagagctgggg
aagcctgatgctgagctgtggaacagtcggccggatatactggagaggagtagagcttct
gtggatgccctctgcaggcgtaactacaagctgggtgcacccttcactgtgaggaggaaa
gtacaaccagaggtgacagtgtatccagagaggatcccgtccctgcagcaccgcaatttg
ctgctctgctctgtgacaggtttctatccaggagacatcaagatcaggtggttccggaat
gggcaggaggagagggtcggggtcatgtccactggcctcatcaggaatggagactggacc
ttccagacaatggtgatgctggaaatgactcctgaacttggagatgtctacacttgcctt
gttaatcatcccagcctgctgagccctatttctgtggagtggagagctcagtctgcatat
tcttggagaaagatgctaagtggaagtgcaaccttcctgcttgggctgatcttctttctc
gtggggactgtcatctgcctcagggctcagaaaggatatgtgcagattcagttgtctggt
gatgaggtctcaagcgcagttccttcaccacaaccatgctaa

KEGG   Ursus arctos horribilis: 113243784
Entry
113243784         CDS       T05909                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243784
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243784
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243784
   04612 Antigen processing and presentation
    113243784
   04658 Th1 and Th2 cell differentiation
    113243784
   04659 Th17 cell differentiation
    113243784
   04672 Intestinal immune network for IgA production
    113243784
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243784
   05322 Systemic lupus erythematosus
    113243784
   05323 Rheumatoid arthritis
    113243784
   05320 Autoimmune thyroid disease
    113243784
   05321 Inflammatory bowel disease (IBD)
    113243784
   05330 Allograft rejection
    113243784
   05332 Graft-versus-host disease
    113243784
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243784
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243784
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243784
   05152 Tuberculosis
    113243784
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243784
   05164 Influenza A
    113243784
   05168 Herpes simplex virus 1 infection
    113243784
   05169 Epstein-Barr virus infection
    113243784
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243784
   05140 Leishmaniasis
    113243784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243784
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243784
  Exosomal proteins of epithelial cells
   113243784
  Exosomal proteins of breast milk
   113243784
SSDB
Motif
Pfam: C1-set MHC_II_beta Ig_2 Ig_3 I-set C2-set_2 ig
Other DBs
NCBI-GeneID: 113243784
NCBI-ProteinID: XP_026338414
UniProt: A0A3Q7UDX2
LinkDB
Position
Unknown
AA seq 263 aa
MTTLLPLLLGLSLGSTTAGGFIAHVESACLLDDDGTPKDFAYCVSFNKDLLTCWDSVEGK
MAPCEFGALNFLAKYLSDYLNQQEPLLQRLSNGLQDCAARTQSFWGSLTRRTRPPTVQVA
KTTPFNTKEHVMLACYVWGFYPADVTISWRKNGQPVPPHSSAPKMAQPNGDWTYQTVSYL
ATTPSYGDTYTCVVEHIGAPEPVCEDWTAGLSPMQTVKVSLSAVTLGLGFIIFFLGLLSW
RRAGPSGYILLPGDGYPEGQHVN
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaccacactcctgcccttgctgctgggcctcagcctgggctccaccacagcaggtggc
tttatagcccatgtggaaagcgcctgtctgttggatgatgatgggactccaaaggatttc
gcatattgtgtctccttcaacaaggatttgttgacctgctgggattcggtggagggcaaa
atggccccttgtgaatttggggcactgaatttcttggccaagtacctctcagattacctc
aaccaacaggaacccctgctccagcgcttgtctaatgggctccaggactgtgctgcacgt
acccagtccttctggggatcactgacccgcaggacaaggccaccgactgtgcaagtagcc
aaaaccactccttttaacacgaaggagcatgtgatgctggcctgctacgtgtggggcttc
tatccagctgatgtgaccatctcgtggaggaagaacgggcagcctgtccctcctcacagt
agcgcccctaagatggcccagcccaatggagactggacataccagactgtctcctattta
gctaccaccccctcttacggggacacctacacctgtgtggtggagcacatcggggctcct
gagcccgtctgcgaggactggacagctgggctgtccccgatgcagacagtgaaggtttct
ctgtctgcagtgactctgggcctgggcttcatcattttctttcttggtttgctcagctgg
cggagagctggcccctctggctacattttgcttcctggggacggttatcctgaaggtcaa
cacgtcaattag

KEGG   Ursus arctos horribilis: 113243786
Entry
113243786         CDS       T05909                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain isoform X1
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243786
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243786
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243786
   04612 Antigen processing and presentation
    113243786
   04658 Th1 and Th2 cell differentiation
    113243786
   04659 Th17 cell differentiation
    113243786
   04672 Intestinal immune network for IgA production
    113243786
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243786
   05322 Systemic lupus erythematosus
    113243786
   05323 Rheumatoid arthritis
    113243786
   05320 Autoimmune thyroid disease
    113243786
   05321 Inflammatory bowel disease (IBD)
    113243786
   05330 Allograft rejection
    113243786
   05332 Graft-versus-host disease
    113243786
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243786
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243786
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243786
   05152 Tuberculosis
    113243786
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243786
   05164 Influenza A
    113243786
   05168 Herpes simplex virus 1 infection
    113243786
   05169 Epstein-Barr virus infection
    113243786
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243786
   05140 Leishmaniasis
    113243786
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243786
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243786
  Exosomal proteins of epithelial cells
   113243786
  Exosomal proteins of breast milk
   113243786
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6
Other DBs
NCBI-GeneID: 113243786
NCBI-ProteinID: XP_026338421
UniProt: A0A3Q7TQP8
LinkDB
Position
Unknown
AA seq 261 aa
MDREQRPGAALLRLLQLLWLLPSSRTAPEAPAPVWRDELQNHTFLHTMYCQNWSPSVGLS
EAYDGDQLFSFDFTQNTRVPRLPEFADWTQKPGDISTIFFEKAFCWAMIQEIGPKLEGHI
PVSRGFPVVDMFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWRHHLDPVEGIGPTFVSAVD
ELSFQAFSYLNFTPAPSDLFSCIVTHEIDNHTAVAYWVPRNALPSDLLENVLCGVAFGLG
VLGIIVGLVLLIYFRKPCLGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggatcgtgagcagaggccaggagctgcactgctaaggctgttacagctcctgtggctg
ctgccctcctcccggaccgcccctgaagctcctgctccagtgtggcgggacgaactgcaa
aaccacacgttcctgcacacgatgtactgccagaactggagtcccagcgtcggcctctcg
gaagcctatgacggggaccagcttttctctttcgacttcacccagaacacccgagtgcct
cgcctgcctgagtttgctgactggactcagaagcccggagatatttccaccattttcttt
gaaaaagcgttctgctgggctatgatccaggaaataggaccaaaacttgaagggcacatc
cctgtgtctagagggtttcctgttgttgacatgttcacactgaagcccctggagtttggc
aagcccaacacgctggtctgttttgtcagtaatctcttcccacccacattgacggtgaac
tggaggcatcacttggaccctgtggaaggaatagggcccacttttgtgtccgccgttgat
gaactcagcttccaggccttttcttacttaaacttcacaccagcaccctctgaccttttc
tcctgcattgtgactcatgaaattgacaaccacacggcagttgcctattgggtgccccgt
aatgcgctgccctctgatcttctggagaatgtgctctgcggtgtggcctttggcctgggt
gtgctgggtatcattgttggcttagtgctcctcatctacttccgaaagccctgcttaggg
gattga

KEGG   Ursus arctos horribilis: 113243788
Entry
113243788         CDS       T05909                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04145  Phagosome
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243788
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113243788
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243788
   04612 Antigen processing and presentation
    113243788
   04658 Th1 and Th2 cell differentiation
    113243788
   04659 Th17 cell differentiation
    113243788
   04672 Intestinal immune network for IgA production
    113243788
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113243788
   05322 Systemic lupus erythematosus
    113243788
   05323 Rheumatoid arthritis
    113243788
   05320 Autoimmune thyroid disease
    113243788
   05321 Inflammatory bowel disease (IBD)
    113243788
   05330 Allograft rejection
    113243788
   05332 Graft-versus-host disease
    113243788
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243788
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243788
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113243788
   05152 Tuberculosis
    113243788
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243788
   05164 Influenza A
    113243788
   05168 Herpes simplex virus 1 infection
    113243788
   05169 Epstein-Barr virus infection
    113243788
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243788
   05140 Leishmaniasis
    113243788
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243788
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113243788
  Exosomal proteins of epithelial cells
   113243788
  Exosomal proteins of breast milk
   113243788
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 113243788
NCBI-ProteinID: XP_026338423
UniProt: A0A3Q7UQK8
LinkDB
Position
Unknown
AA seq 246 aa
MVFNGGLILGLHTLMSLLSPHETGAIKADHMGSYGPAFYQSYDASGQFSYEFDGEQLFSV
ELKKREAVWRLPEFGNFAYFDPQNGLASIAMIRAHLDVLVERSNRTRATNVPPRVAVLPK
FRVELGQPNVLICIVDNIFPPVINITWLRNGQIVSEGVAQTSFYSQPDHLFRKFCYLTFV
PFADDMYDCKVEHWGLEEPLLRHWEPQVPLPVPDTTETLICALGLALGFVGTILLIRGTC
LSSARR
NT seq 741 nt   +upstreamnt  +downstreamnt
atggtcttcaacgggggtctaatcctgggactccacaccttgatgagcctcctgagcccc
cacgaaactggggccatcaaggctgatcacatgggctcctatggaccagccttctaccag
tcctatgatgcctcgggtcagttttcctatgaatttgatggggaacagctgttctctgtg
gagctgaagaagagggaggccgtgtggcgtttacctgagtttggcaacttcgcctacttt
gacccacagaatgggctggccagcatcgccatgatcagagcccatctggatgtcttggtg
gaacgctccaaccgcaccagagccaccaacgtgcctccaagggtggctgtactccccaag
tttcgagtggagctgggccagcccaacgtcctcatctgcattgtggacaacatcttccct
cctgtgatcaatatcacctggctgcgcaacggtcaaatagtcagcgagggggtggcccag
accagcttctattcccagcctgaccatctgttccgcaagttctgctacctgacgttcgtg
ccctttgcagacgacatgtatgactgcaaggtggagcactggggcctggaggagccgctc
ctccggcactgggagccccaggtgcctctcccagtgccagacaccactgagactctgatc
tgtgcccttggcctggctctcggcttcgtgggcaccatcctcctcatcagaggcacgtgc
ttgtccagtgcccgcaggtaa

KEGG   Ursus arctos horribilis: 113243878
Entry
113243878         CDS       T05909                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, A-32 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243878
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113243878
   04145 Phagosome
    113243878
  09143 Cell growth and death
   04218 Cellular senescence
    113243878
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113243878
   04612 Antigen processing and presentation
    113243878
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113243878
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113243878
   05330 Allograft rejection
    113243878
   05332 Graft-versus-host disease
    113243878
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243878
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243878
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243878
   05170 Human immunodeficiency virus 1 infection
    113243878
   05168 Herpes simplex virus 1 infection
    113243878
   05163 Human cytomegalovirus infection
    113243878
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243878
   05169 Epstein-Barr virus infection
    113243878
   05165 Human papillomavirus infection
    113243878
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243878
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113243878
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113243878
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113243878
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 DUF202 C2-set_2 Ig_2 ig EphA2_TM
Other DBs
NCBI-GeneID: 113243878
NCBI-ProteinID: XP_026338588
UniProt: A0A3Q7UR08
LinkDB
Position
Unknown
AA seq 354 aa
MHLPQTLKVWAMGPRTLLLLLSGALAVTETWAGSHSLRYFSIAVSRPGRGEPRYWEVGYV
HDTQFVRFDSYAANRRMEPRAPWVEQEGPEYWDPETRNAEDHAQISRRNLRVALGYYNQS
EAGSHTLQGTSACDXGPDGRLLRGYEQLAYDGVDYIALNEDLRSWTAEDTVAQITRRKWE
AAGGAERSRNYLEVTCVESLRRYLKNWNETLQRAEQPKTHVSHHSISDHDVTLRCWALGF
YPAEITLTWHCDGEDLPQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPE
PITLRWEPPPQPTMGVIAGLILFVIAVVVVAVMWRKKLSGRTRNYSHAACDDIA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcacctacctcagaccctgaaggtctgggccatggggccccgaaccctcctcctgctg
ctctcaggggccctggccgtgaccgagacctgggcgggctcgcactccctgaggtatttc
tccatcgccgtgtcccggcccggccgcggggagccccggtactgggaagtcggctacgtg
cacgacacgcagttcgtgcggttcgacagctatgcggcgaaccggaggatggagccgcgg
gcgccgtgggtggagcaggaggggccggagtactgggacccggagacgcggaacgccgaa
gaccacgcacagatttcgcgacggaacctacgggtcgctctcggctactacaaccagagc
gaggcgggctctcacaccctccaggggacgtctgcttgcgacngtgggccggacgggcgc
ctcctccgcgggtatgagcagttggcctacgacggcgtggattacatcgccctgaacgag
gacctgcgctcctggaccgcggaggacacggtggcgcagatcacccggcgcaagtgggag
gcggccggtggcgcagagcgctccagaaactacctggaggtcacgtgcgtggagtccctc
cgcaggtacctgaagaactggaatgagacgctgcagcgcgcagaacagcccaaaacacat
gtgagccaccactccatctctgaccatgatgtcaccctgaggtgctgggccctgggcttc
taccctgcggagatcaccctgacctggcactgtgatggggaggacctgccccaggacacg
gagcttgtggagaccaggcctgcaggagatgggaccttccagaagtgggcagctgtggtg
gtgccttctggacaggagcagagatacacatgccatgtgcagcatgaggggctgcccgag
cccatcaccttgagatgggagccgcctcctcagcccaccatgggcgtcattgctggtctg
attctctttgtgatcgctgtggtggtcgtagctgtgatgtggagaaagaagctctcaggt
agaacaagaaactactctcacgctgcatgtgatgacattgcctag

KEGG   Ursus arctos horribilis: 113249452
Entry
113249452         CDS       T05909                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-11 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113249452
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113249452
   04145 Phagosome
    113249452
  09143 Cell growth and death
   04218 Cellular senescence
    113249452
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113249452
   04612 Antigen processing and presentation
    113249452
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113249452
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113249452
   05330 Allograft rejection
    113249452
   05332 Graft-versus-host disease
    113249452
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113249452
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113249452
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113249452
   05170 Human immunodeficiency virus 1 infection
    113249452
   05168 Herpes simplex virus 1 infection
    113249452
   05163 Human cytomegalovirus infection
    113249452
   05167 Kaposi sarcoma-associated herpesvirus infection
    113249452
   05169 Epstein-Barr virus infection
    113249452
   05165 Human papillomavirus infection
    113249452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113249452
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113249452
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113249452
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113249452
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 113249452
NCBI-ProteinID: XP_026346749
UniProt: A0A3Q7VVY7
LinkDB
Position
Unknown
AA seq 248 aa
MQVVMTRTLVLLLSGALAVTETWAGSHSLRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDSASQRMEPRAPWVEQEGPEYWDRETRNVKGTAQTDRVDLQTLRGYYNQSEAGSHTVQ
RMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADTAAQITRRKWEAAGVAEHD
RNYVEGTCVEWLRRYLENGKETLQRAETPKDGLRAQPRPEPRLTRPHDVAAHGRSRRQDE
VWVMSESL
NT seq 747 nt   +upstreamnt  +downstreamnt
atgcaggtcgtgatgacccgaaccctcgtcctgctgctgtcgggggccctggccgtgacc
gagacctgggcgggctcgcactccctgaggtatttctacacctccgtgtcccggcccggc
cgcggggagccccgcttcatcgccgtcggctacgtggacgacacgcagttcgtgcggttc
gacagcgactctgccagtcagaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccgggagacgcggaacgtcaagggcaccgcacagactgaccgagtg
gacctgcagaccctgcgcggctactacaaccagagcgaggccggctctcacaccgtccag
cgcatgtacggctgcgacgtggggcccgacgggcgcctcctccgcgggtacagacaggac
gcctacgacggcgcggattacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacacggcggcgcagatcacccggcgcaagtgggaggcggccggtgtggcagagcacgac
aggaactacgtggagggcacgtgcgtggagtggctccgcaggtacctggagaacgggaag
gagacgctgcagcgcgcagaaacccccaaagatgggctgagggcccaacccaggcctgag
cccaggctgacccggccccacgacgttgctgcccacggtcggtcccggaggcaggacgag
gtctgggtgatgtccgagtctctgtga

KEGG   Ursus arctos horribilis: 113250163
Entry
113250163         CDS       T05909                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113250163
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113250163
   04145 Phagosome
    113250163
  09143 Cell growth and death
   04218 Cellular senescence
    113250163
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113250163
   04612 Antigen processing and presentation
    113250163
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113250163
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113250163
   05330 Allograft rejection
    113250163
   05332 Graft-versus-host disease
    113250163
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113250163
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113250163
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113250163
   05170 Human immunodeficiency virus 1 infection
    113250163
   05168 Herpes simplex virus 1 infection
    113250163
   05163 Human cytomegalovirus infection
    113250163
   05167 Kaposi sarcoma-associated herpesvirus infection
    113250163
   05169 Epstein-Barr virus infection
    113250163
   05165 Human papillomavirus infection
    113250163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113250163
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113250163
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113250163
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113250163
SSDB
Motif
Pfam: MHC_I MATalpha_HMGbox
Other DBs
NCBI-GeneID: 113250163
NCBI-ProteinID: XP_026347318
UniProt: A0A3Q7VE64
LinkDB
Position
Unknown
AA seq 287 aa
MSSCLETPDAACFAFPLGVGLLEKPISGSPVSDYKVFAPAPGPSGYSESTETPDMQILLR
RSLVLLLSGALAMTETWAGSHSLRYFHTAVFRPGRGEPRFISVGYVDDTQFVRFDSDSAS
RRAEPRAPWMEQEGPEYWDRETRNAKDNAQTFRLDLNNLRGYYNQSEAGSHTIQWMYGCD
VGPDGRLLRGYEQFAYDGADYIALNEDLRSWTAADTAAQITRSRWEAAGDAEHDRNYVEC
TCVEWLRRYLENGKETLQRAETPNTHVTRHPISDQRVTLRCWALGFY
NT seq 861 nt   +upstreamnt  +downstreamnt
atgtcctcctgcctggagactcctgacgcagcctgcttcgcattcccattgggtgtcggg
cttctggagaagccaatcagcggctccccggtttccgattataaagtcttcgcacccgcc
ccagggccaagcggctactcagagtctaccgagaccccggacatgcagatcctgctgcgc
cgatccctcgtcctgctactgtcgggggctctggccatgaccgagacctgggcgggctcg
cactccctgaggtatttccacaccgcggtgttccggcccggccgcggggagccccgcttc
atctctgtcggctacgtggacgacacgcagttcgtgcggttcgacagcgactctgccagt
cggagggccgagccgcgggcgccgtggatggagcaggaggggcccgagtattgggaccgg
gagacgcggaatgccaaggacaacgcgcagactttccgactggacctgaacaacctgcgg
ggctactacaaccagagcgaggccggctctcacaccatccagtggatgtacggctgcgac
gtgggacccgacgggcgcctcctccgcggttatgagcagttcgcctacgacggcgcggat
tacatcgccctgaacgaggacctgcgctcctggaccgcggcggacacggcggctcagatc
acccggagcaggtgggaggcggcaggtgatgcagagcacgacaggaactacgtggagtgc
acctgcgtggagtggctccgcaggtacctggagaacgggaaggagacactgcaacgtgca
gaaacccccaacacacatgtgacccgccatcccatctccgaccaaagggtcaccctgagg
tgctgggccctgggcttctac

KEGG   Ursus arctos horribilis: 113261534
Entry
113261534         CDS       T05909                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113261534
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113261534
   04145 Phagosome
    113261534
  09143 Cell growth and death
   04218 Cellular senescence
    113261534
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113261534
   04612 Antigen processing and presentation
    113261534
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113261534
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113261534
   05330 Allograft rejection
    113261534
   05332 Graft-versus-host disease
    113261534
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113261534
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113261534
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113261534
   05170 Human immunodeficiency virus 1 infection
    113261534
   05168 Herpes simplex virus 1 infection
    113261534
   05163 Human cytomegalovirus infection
    113261534
   05167 Kaposi sarcoma-associated herpesvirus infection
    113261534
   05169 Epstein-Barr virus infection
    113261534
   05165 Human papillomavirus infection
    113261534
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113261534
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113261534
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113261534
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113261534
SSDB
Motif
Pfam: MHC_I C1-set ig MHC_I_3 C2-set_2 Herpes_gp2 CCB1
Other DBs
NCBI-GeneID: 113261534
NCBI-ProteinID: XP_026363460
UniProt: A0A3Q7XL96
LinkDB
Position
Unknown
AA seq 392 aa
MLLLLQLLGLVPECVAESPWGLPLVADGPASLAKVVMAELADLKLGNKPWPGGTHSLHYH
YLAVSEPGPGLPQFLAVGYVDDQPFIHYDSRVDRAKPQAPWMATVDAQYWETETQKQRTW
AKVQQVETWTVMGYHNHSSGMHSTQRMFGCEIREDGRTSSFWQFGFDGQDHVSLDLETLS
WVSAKPAAVRTKRWWETERCYAEYDKAYLEGLCLISLHRYLELGGQSLTRKEPPTVQVTR
HTAQDGGITLKCWARGFYPRDISLSWWLGEEELVLETEYVETRPSGDGTYQTWAAVRVPA
RKEDWYTCHVQHSGLNHTLTVAWEAPSHQWKTSAVVVSTIFTITFLLMAGVWIFIKQYSQ
ARNKESCNQAPGGEDPQNSQSPVTVEATQLLC
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgctgctgctcctgcagctgttgggtctagtgccggagtgcgtggcagagagtccctgg
gggctgcctttggtggccgatggcccagcttccttagcgaaggtggtgatggcagaacta
gccgacctgaagttaggaaacaagccatggcctggagggacgcactctctccactaccac
tacctggccgtgtcagagccaggcccgggccttccccagtttctggccgtaggctacgtg
gatgaccagcccttcatccattacgacagtcgtgtggacagggccaagccccaggcccca
tggatggcaaccgtggacgcccagtactgggagacagagacccagaagcagaggacctgg
gcgaaggtgcagcaggtggagacgtggaccgtgatgggctaccacaaccacagcagtggc
atgcacagcactcagcggatgtttggctgtgagatccgggaggacggccgtaccagcagc
ttctggcagtttggctttgatgggcaggaccacgtgtcactggacctggagactctgagc
tgggtgtcagccaaacctgcggccgtgcggaccaagcgctggtgggagacagagcgctgc
tatgctgagtatgacaaggcctacctggaaggcctctgcctcatttccctgcacaggtac
ctggagctgggaggccagagcctcacccggaaagagccgcccacagtgcaggtgacaaga
cacacagcccaggatggaggcatcaccctgaaatgctgggcccggggcttctacccacgg
gacatctcattgagctggtggctgggtgaggaggagctggttctagagactgagtacgtg
gagacacgccccagtggagatggcacctaccagacatgggcagccgtgcgggtgccggcc
aggaaggaggactggtacacttgccacgtgcagcactctggcctgaaccatacgctcact
gtggcctgggaagcaccctctcatcagtggaaaaccagtgctgtggttgtctccactatc
ttcaccatcactttcttgctgatggctggagtgtggatcttcatcaagcagtactctcaa
gccaggaataaggaatcttgcaatcaagccccaggtggagaggaccctcagaattcccaa
agcccagtgacagtggaggccactcagctgctctgctga

KEGG   Ursus arctos horribilis: 113264228
Entry
113264228         CDS       T05909                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, A-3 alpha chain
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113264228
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113264228
   04145 Phagosome
    113264228
  09143 Cell growth and death
   04218 Cellular senescence
    113264228
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113264228
   04612 Antigen processing and presentation
    113264228
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113264228
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113264228
   05330 Allograft rejection
    113264228
   05332 Graft-versus-host disease
    113264228
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113264228
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113264228
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113264228
   05170 Human immunodeficiency virus 1 infection
    113264228
   05168 Herpes simplex virus 1 infection
    113264228
   05163 Human cytomegalovirus infection
    113264228
   05167 Kaposi sarcoma-associated herpesvirus infection
    113264228
   05169 Epstein-Barr virus infection
    113264228
   05165 Human papillomavirus infection
    113264228
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113264228
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113264228
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113264228
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113264228
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 113264228
NCBI-ProteinID: XP_026366924
UniProt: A0A3Q7XKA4
LinkDB
Position
Unknown
AA seq 378 aa
MDDNSDTLSTEKTASAWEEGGGRRTQALLRRLALTSAPLTPGSLLFSDPLALFRRPNLPR
PLPSRPPPPAPRAPRREEGRTGSQPLRARRLALPAVFGHRRVPARPRGSRLRALHAVRAV
RQRRSESRDGAAGAAGGAGGAGVLGPGDAGLRDLHTDSGGKLNEVRGHYNQSEAGSHTFQ
RMIGXWALPARAPSDAYDGADYIVPNDDLLSWTAADTAAQIARRKWEATGEAEHYGNYLD
GACVEWLRRQLENAKETLRRAEPHNTHVTXHRFSDHDVTLRCWALGFYPAEITLTWQQDG
EDLTQATEHVETRPAGDGTSQKWAAXEEQRYPCHVQHEGLPEPLTXRWELLPEPTIPTMG
IIAGLVLPAVTGAVVAGA
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggatgacaacagtgacaccctttctacagagaaaaccgcctcagcgtgggaggaggga
gggggccgccggacccaagcgctgctccgccgcctggcactcacctccgccccactcaca
cctgggtccctactcttctccgacccactggcccttttccgtcgcccgaacctccctcgc
cccctgccctcccggccgcctccacctgcgccccgggccccgcggcgggaggagggtcgg
acggggtctcagcccctccgcgcccgcaggcttgcactccctgcggtatttgggcaccgc
cgtgtcccggcccggccgcggggaagtcggctacgtgcactacacgcagttcgcgcggtt
cgacagcgacgcagcgagtcccgggatggagccgcgggcgccgcgggtggagcaggaggg
gccggagtattgggacccggagacgcgggactccgggacctgcacacagactccggaggg
aaactgaacgaagtgcgcggccactacaaccagagcgaggcagggtctcacaccttccag
agaatgataggctgatgggcgcttcctgcgcgggcaccttctgacgcctacgacggcgcg
gattacatcgtcccgaacgacgacctgctctcctggaccgcggcggacaccgcggcgcag
atcgcccggcgcaagtgggaggcgacaggtgaggctgaacactacgggaactatctggac
ggcgcgtgcgtggagtggctccgcaggcagctggagaacgcgaaggagacgctgcggcgc
gcagaaccccacaacacacatgtgaccntgcaccgcttctctgaccatgatgtcaccctg
agatgctgggctctgggcttctaccctgcggagatcaccctgacctggcagcaggatggg
gaggacctgacccaggccacagaacatgtggagaccaggcctgcgggagatgggacctcc
cagaagtgggcagccnaagaggagcagagatacccgtgccacgtgcagcatgaggggctg
cctgagcccctcacctagagatgggagctgctgcctgagcccaccatccccaccatgggc
atcattgctggcctggttctccctgcggtcacgggagctgtggtggcgggagcatga

DBGET integrated database retrieval system