KEGG   Ursus arctos horribilis: 113243704
Entry
113243704         CDS       T05909                                 

Definition
(RefSeq) DLA class I histocompatibility antigen, A9/A9 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243704
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113243704
   04145 Phagosome
    113243704
  09143 Cell growth and death
   04218 Cellular senescence
    113243704
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113243704
   04612 Antigen processing and presentation
    113243704
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113243704
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113243704
   05330 Allograft rejection
    113243704
   05332 Graft-versus-host disease
    113243704
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243704
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243704
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243704
   05170 Human immunodeficiency virus 1 infection
    113243704
   05168 Herpes simplex virus 1 infection
    113243704
   05163 Human cytomegalovirus infection
    113243704
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243704
   05169 Epstein-Barr virus infection
    113243704
   05165 Human papillomavirus infection
    113243704
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243704
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113243704
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113243704
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113243704
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig Ig_2 MATalpha_HMGbox EphA2_TM
Other DBs
NCBI-GeneID: 113243704
NCBI-ProteinID: XP_026338255
UniProt: A0A3Q7UDG5
LinkDB
Position
Unknown
AA seq 418 aa
MSSCLETPDAACFAFPLGVGLLEKPISGSPVSDYKVFAPAPGPSGYSESTETPDMQILLR
RSLVLLLSGALAMTETWAGSHSLRYFHTAVFRPGRGEPRFISVGYVDDTQFVRFDSDSAS
RRAEPRAPWMEQEGPEYWDRETRNAKDNAQTFRLDLNNLRGYYNQSEAGSHTIQWMYGCD
VGPDGRLLRGYEQFAYDGADYIALNEDLRSWTAADTAAQITRSRWEAAGDAEHDRNYVEC
TCVEWLRRYLENGKETLQRAETPNTHVTRHPISDQRVTLRCWALGFYPAEITLTWHHDGE
DLTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPPPQPTI
TVPITWIIAGLVLLTVTVAIGAVIWRRKRSGGKGPSYSHAARDDSAQGSDVSLTVPKV
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtcctcctgcctggagactcctgacgcagcctgcttcgcattcccattgggtgtcggg
cttctggagaagccaatcagcggctccccggtttccgattataaagtcttcgcacccgcc
ccagggccaagcggctactcagagtctaccgagaccccggacatgcagatcctgctgcgc
cgatccctcgtcctgctactgtcgggggctctggccatgaccgagacctgggcgggctcg
cactccctgaggtatttccacaccgcggtgttccggcccggccgcggggagccccgcttc
atctctgtcggctacgtggacgacacgcagttcgtgcggttcgacagcgactctgccagt
cggagggccgagccgcgggcgccgtggatggagcaggaggggcccgagtattgggaccgg
gagacgcggaatgccaaggacaacgcgcagactttccgactggacctgaacaacctgcgg
ggctactacaaccagagcgaggccggctctcacaccatccagtggatgtacggctgcgac
gtgggacccgacgggcgcctcctccgcggttatgagcagttcgcctacgacggcgcggat
tacatcgccctgaacgaggacctgcgctcctggaccgcggcggacacggcggctcagatc
acccggagcaggtgggaggcggcaggtgatgcagagcacgacaggaactacgtggagtgc
acctgcgtggagtggctccgcaggtacctggagaacgggaaggagacactgcaacgtgca
gaaacccccaacacacatgtgacccgccatcccatctccgaccaaagggtcaccctgagg
tgctgggccctgggcttctaccctgcggagatcaccctgacctggcaccacgatggggag
gacctgacccaggacacagagcttgtggagaccaggcctgcaggagatgggaccttccag
aagtgggcagctgtggtggtgccttctggagaggagcagagatacacgtgccatgtgcag
catgaggggctgcccgagcccctcacactgagatgggagccacctcctcagcccaccatc
accgtccccatcacgtggatcatcgctggtctggttctccttacagtcactgtggcgatt
ggagctgtgatctggaggaggaagcgctcaggaggaaaaggaccgagttactctcacgct
gcacgcgatgacagtgcccagggctctgatgtgtctcttacggttcctaaagtgtga

KEGG   Ursus arctos horribilis: 113243706
Entry
113243706         CDS       T05909                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, alpha chain G-like isoform X1
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243706
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113243706
   04145 Phagosome
    113243706
  09143 Cell growth and death
   04218 Cellular senescence
    113243706
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113243706
   04612 Antigen processing and presentation
    113243706
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113243706
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113243706
   05330 Allograft rejection
    113243706
   05332 Graft-versus-host disease
    113243706
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243706
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243706
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243706
   05170 Human immunodeficiency virus 1 infection
    113243706
   05168 Herpes simplex virus 1 infection
    113243706
   05163 Human cytomegalovirus infection
    113243706
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243706
   05169 Epstein-Barr virus infection
    113243706
   05165 Human papillomavirus infection
    113243706
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243706
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113243706
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113243706
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113243706
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2 ig
Other DBs
NCBI-GeneID: 113243706
NCBI-ProteinID: XP_026338257
UniProt: A0A3Q7VJW9
LinkDB
Position
Unknown
AA seq 383 aa
MRVVMPRTLLLLLSGALAVTETWEGSHSLRYFGTSVSRPGRGEPRYVEVGYVDDTQFARF
DSDSASRRMEPRAPWVEQEGPEFWDQETRGAKDTAQTFRGDLQTLRGYYNQSEAGSHTIQ
WTSACDVGLDWRLLRGYWQLAYDGADYIALNEDLRSWTAADTAAQITRRKWEVAGAAEQQ
RNELEVTCVEWLRRYLEMGNKTLLRTGAEALQPPRSVNLVAASCPCRSSRGGACCWDSQV
DFALVELDLPCRLCAQHPPKTHVTYHPLTDHEVTLRCWALGFSPAEITLTWHHDGEDLTQ
DTELVEPRPAGDGTFQKWAAVVVPSGEEQRYTCRVQHGGLPEPLTLRWESPPRPLIPVVG
IMAGLVVVVVTGAVLVGAVMWRK
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgcgagtcgtaatgccccgaaccctcctcctgctgctgtcaggggccctggcggtgacc
gagacctgggagggctcccactccctgaggtatttcggcacctccgtgtcccggcccggc
cgcggggagccccggtacgtggaagtcggctacgtggacgacacgcagttcgcgcggttc
gacagcgactctgccagtcggaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagttttgggaccaggagacgcggggcgccaaggacaccgcacagactttccgaggg
gacctgcagacactgcggggctactacaaccagagcgaggccgggtctcacaccatccag
tggacgtctgcttgcgacgtggggctggactggcgcctcctccgcgggtactggcagttg
gcctacgacggcgccgattacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacacggcggcgcagatcacccggcgcaagtgggaggtggccggtgcagcggagcagcag
aggaacgagctggaggtcacgtgcgtggaatggctccggaggtacctggagatggggaat
aagacgctgctgcgcacaggggccgaagctttgcagcccccaaggtcagttaacttggtg
gcagcgagttgtccctgccggtcttctaggggcggggcctgttgctgggattctcaggtg
gactttgctctggtagaactggacctcccttgcagactctgcgctcagcatcccccgaag
acacatgtcacctaccatcccctcactgaccatgaggtcaccctgaggtgctgggccctg
ggcttctcccctgcggagatcaccctgacctggcaccacgatggggaggacctgacccag
gatacagagcttgtggagccgaggcctgcaggggatgggaccttccagaagtgggcggct
gtggtggtgccttctggagaggagcagagatacacgtgccgtgtgcagcatggggggctg
cctgagcccctcacactgagatgggagtcccctcctcggcccctcattcccgtcgtgggc
atcatggctggtctggttgtggttgtggtcactggcgctgtgctggttggagctgtcatg
tggaggaaatag

KEGG   Ursus arctos horribilis: 113243878
Entry
113243878         CDS       T05909                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, A-32 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113243878
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113243878
   04145 Phagosome
    113243878
  09143 Cell growth and death
   04218 Cellular senescence
    113243878
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113243878
   04612 Antigen processing and presentation
    113243878
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113243878
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113243878
   05330 Allograft rejection
    113243878
   05332 Graft-versus-host disease
    113243878
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243878
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113243878
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243878
   05170 Human immunodeficiency virus 1 infection
    113243878
   05168 Herpes simplex virus 1 infection
    113243878
   05163 Human cytomegalovirus infection
    113243878
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243878
   05169 Epstein-Barr virus infection
    113243878
   05165 Human papillomavirus infection
    113243878
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243878
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113243878
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113243878
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113243878
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 DUF202 C2-set_2 Ig_2 ig EphA2_TM
Other DBs
NCBI-GeneID: 113243878
NCBI-ProteinID: XP_026338588
UniProt: A0A3Q7UR08
LinkDB
Position
Unknown
AA seq 354 aa
MHLPQTLKVWAMGPRTLLLLLSGALAVTETWAGSHSLRYFSIAVSRPGRGEPRYWEVGYV
HDTQFVRFDSYAANRRMEPRAPWVEQEGPEYWDPETRNAEDHAQISRRNLRVALGYYNQS
EAGSHTLQGTSACDXGPDGRLLRGYEQLAYDGVDYIALNEDLRSWTAEDTVAQITRRKWE
AAGGAERSRNYLEVTCVESLRRYLKNWNETLQRAEQPKTHVSHHSISDHDVTLRCWALGF
YPAEITLTWHCDGEDLPQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPE
PITLRWEPPPQPTMGVIAGLILFVIAVVVVAVMWRKKLSGRTRNYSHAACDDIA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcacctacctcagaccctgaaggtctgggccatggggccccgaaccctcctcctgctg
ctctcaggggccctggccgtgaccgagacctgggcgggctcgcactccctgaggtatttc
tccatcgccgtgtcccggcccggccgcggggagccccggtactgggaagtcggctacgtg
cacgacacgcagttcgtgcggttcgacagctatgcggcgaaccggaggatggagccgcgg
gcgccgtgggtggagcaggaggggccggagtactgggacccggagacgcggaacgccgaa
gaccacgcacagatttcgcgacggaacctacgggtcgctctcggctactacaaccagagc
gaggcgggctctcacaccctccaggggacgtctgcttgcgacngtgggccggacgggcgc
ctcctccgcgggtatgagcagttggcctacgacggcgtggattacatcgccctgaacgag
gacctgcgctcctggaccgcggaggacacggtggcgcagatcacccggcgcaagtgggag
gcggccggtggcgcagagcgctccagaaactacctggaggtcacgtgcgtggagtccctc
cgcaggtacctgaagaactggaatgagacgctgcagcgcgcagaacagcccaaaacacat
gtgagccaccactccatctctgaccatgatgtcaccctgaggtgctgggccctgggcttc
taccctgcggagatcaccctgacctggcactgtgatggggaggacctgccccaggacacg
gagcttgtggagaccaggcctgcaggagatgggaccttccagaagtgggcagctgtggtg
gtgccttctggacaggagcagagatacacatgccatgtgcagcatgaggggctgcccgag
cccatcaccttgagatgggagccgcctcctcagcccaccatgggcgtcattgctggtctg
attctctttgtgatcgctgtggtggtcgtagctgtgatgtggagaaagaagctctcaggt
agaacaagaaactactctcacgctgcatgtgatgacattgcctag

KEGG   Ursus arctos horribilis: 113249452
Entry
113249452         CDS       T05909                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-11 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113249452
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113249452
   04145 Phagosome
    113249452
  09143 Cell growth and death
   04218 Cellular senescence
    113249452
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113249452
   04612 Antigen processing and presentation
    113249452
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113249452
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113249452
   05330 Allograft rejection
    113249452
   05332 Graft-versus-host disease
    113249452
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113249452
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113249452
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113249452
   05170 Human immunodeficiency virus 1 infection
    113249452
   05168 Herpes simplex virus 1 infection
    113249452
   05163 Human cytomegalovirus infection
    113249452
   05167 Kaposi sarcoma-associated herpesvirus infection
    113249452
   05169 Epstein-Barr virus infection
    113249452
   05165 Human papillomavirus infection
    113249452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113249452
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113249452
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113249452
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113249452
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 113249452
NCBI-ProteinID: XP_026346749
UniProt: A0A3Q7VVY7
LinkDB
Position
Unknown
AA seq 248 aa
MQVVMTRTLVLLLSGALAVTETWAGSHSLRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDSASQRMEPRAPWVEQEGPEYWDRETRNVKGTAQTDRVDLQTLRGYYNQSEAGSHTVQ
RMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADTAAQITRRKWEAAGVAEHD
RNYVEGTCVEWLRRYLENGKETLQRAETPKDGLRAQPRPEPRLTRPHDVAAHGRSRRQDE
VWVMSESL
NT seq 747 nt   +upstreamnt  +downstreamnt
atgcaggtcgtgatgacccgaaccctcgtcctgctgctgtcgggggccctggccgtgacc
gagacctgggcgggctcgcactccctgaggtatttctacacctccgtgtcccggcccggc
cgcggggagccccgcttcatcgccgtcggctacgtggacgacacgcagttcgtgcggttc
gacagcgactctgccagtcagaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccgggagacgcggaacgtcaagggcaccgcacagactgaccgagtg
gacctgcagaccctgcgcggctactacaaccagagcgaggccggctctcacaccgtccag
cgcatgtacggctgcgacgtggggcccgacgggcgcctcctccgcgggtacagacaggac
gcctacgacggcgcggattacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacacggcggcgcagatcacccggcgcaagtgggaggcggccggtgtggcagagcacgac
aggaactacgtggagggcacgtgcgtggagtggctccgcaggtacctggagaacgggaag
gagacgctgcagcgcgcagaaacccccaaagatgggctgagggcccaacccaggcctgag
cccaggctgacccggccccacgacgttgctgcccacggtcggtcccggaggcaggacgag
gtctgggtgatgtccgagtctctgtga

KEGG   Ursus arctos horribilis: 113250163
Entry
113250163         CDS       T05909                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113250163
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113250163
   04145 Phagosome
    113250163
  09143 Cell growth and death
   04218 Cellular senescence
    113250163
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113250163
   04612 Antigen processing and presentation
    113250163
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113250163
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113250163
   05330 Allograft rejection
    113250163
   05332 Graft-versus-host disease
    113250163
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113250163
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113250163
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113250163
   05170 Human immunodeficiency virus 1 infection
    113250163
   05168 Herpes simplex virus 1 infection
    113250163
   05163 Human cytomegalovirus infection
    113250163
   05167 Kaposi sarcoma-associated herpesvirus infection
    113250163
   05169 Epstein-Barr virus infection
    113250163
   05165 Human papillomavirus infection
    113250163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113250163
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113250163
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113250163
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113250163
SSDB
Motif
Pfam: MHC_I MATalpha_HMGbox
Other DBs
NCBI-GeneID: 113250163
NCBI-ProteinID: XP_026347318
UniProt: A0A3Q7VE64
LinkDB
Position
Unknown
AA seq 287 aa
MSSCLETPDAACFAFPLGVGLLEKPISGSPVSDYKVFAPAPGPSGYSESTETPDMQILLR
RSLVLLLSGALAMTETWAGSHSLRYFHTAVFRPGRGEPRFISVGYVDDTQFVRFDSDSAS
RRAEPRAPWMEQEGPEYWDRETRNAKDNAQTFRLDLNNLRGYYNQSEAGSHTIQWMYGCD
VGPDGRLLRGYEQFAYDGADYIALNEDLRSWTAADTAAQITRSRWEAAGDAEHDRNYVEC
TCVEWLRRYLENGKETLQRAETPNTHVTRHPISDQRVTLRCWALGFY
NT seq 861 nt   +upstreamnt  +downstreamnt
atgtcctcctgcctggagactcctgacgcagcctgcttcgcattcccattgggtgtcggg
cttctggagaagccaatcagcggctccccggtttccgattataaagtcttcgcacccgcc
ccagggccaagcggctactcagagtctaccgagaccccggacatgcagatcctgctgcgc
cgatccctcgtcctgctactgtcgggggctctggccatgaccgagacctgggcgggctcg
cactccctgaggtatttccacaccgcggtgttccggcccggccgcggggagccccgcttc
atctctgtcggctacgtggacgacacgcagttcgtgcggttcgacagcgactctgccagt
cggagggccgagccgcgggcgccgtggatggagcaggaggggcccgagtattgggaccgg
gagacgcggaatgccaaggacaacgcgcagactttccgactggacctgaacaacctgcgg
ggctactacaaccagagcgaggccggctctcacaccatccagtggatgtacggctgcgac
gtgggacccgacgggcgcctcctccgcggttatgagcagttcgcctacgacggcgcggat
tacatcgccctgaacgaggacctgcgctcctggaccgcggcggacacggcggctcagatc
acccggagcaggtgggaggcggcaggtgatgcagagcacgacaggaactacgtggagtgc
acctgcgtggagtggctccgcaggtacctggagaacgggaaggagacactgcaacgtgca
gaaacccccaacacacatgtgacccgccatcccatctccgaccaaagggtcaccctgagg
tgctgggccctgggcttctac

KEGG   Ursus arctos horribilis: 113261534
Entry
113261534         CDS       T05909                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113261534
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113261534
   04145 Phagosome
    113261534
  09143 Cell growth and death
   04218 Cellular senescence
    113261534
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113261534
   04612 Antigen processing and presentation
    113261534
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113261534
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113261534
   05330 Allograft rejection
    113261534
   05332 Graft-versus-host disease
    113261534
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113261534
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113261534
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113261534
   05170 Human immunodeficiency virus 1 infection
    113261534
   05168 Herpes simplex virus 1 infection
    113261534
   05163 Human cytomegalovirus infection
    113261534
   05167 Kaposi sarcoma-associated herpesvirus infection
    113261534
   05169 Epstein-Barr virus infection
    113261534
   05165 Human papillomavirus infection
    113261534
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113261534
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113261534
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113261534
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113261534
SSDB
Motif
Pfam: MHC_I C1-set ig MHC_I_3 C2-set_2 Herpes_gp2 CCB1
Other DBs
NCBI-GeneID: 113261534
NCBI-ProteinID: XP_026363460
UniProt: A0A3Q7XL96
LinkDB
Position
Unknown
AA seq 392 aa
MLLLLQLLGLVPECVAESPWGLPLVADGPASLAKVVMAELADLKLGNKPWPGGTHSLHYH
YLAVSEPGPGLPQFLAVGYVDDQPFIHYDSRVDRAKPQAPWMATVDAQYWETETQKQRTW
AKVQQVETWTVMGYHNHSSGMHSTQRMFGCEIREDGRTSSFWQFGFDGQDHVSLDLETLS
WVSAKPAAVRTKRWWETERCYAEYDKAYLEGLCLISLHRYLELGGQSLTRKEPPTVQVTR
HTAQDGGITLKCWARGFYPRDISLSWWLGEEELVLETEYVETRPSGDGTYQTWAAVRVPA
RKEDWYTCHVQHSGLNHTLTVAWEAPSHQWKTSAVVVSTIFTITFLLMAGVWIFIKQYSQ
ARNKESCNQAPGGEDPQNSQSPVTVEATQLLC
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgctgctgctcctgcagctgttgggtctagtgccggagtgcgtggcagagagtccctgg
gggctgcctttggtggccgatggcccagcttccttagcgaaggtggtgatggcagaacta
gccgacctgaagttaggaaacaagccatggcctggagggacgcactctctccactaccac
tacctggccgtgtcagagccaggcccgggccttccccagtttctggccgtaggctacgtg
gatgaccagcccttcatccattacgacagtcgtgtggacagggccaagccccaggcccca
tggatggcaaccgtggacgcccagtactgggagacagagacccagaagcagaggacctgg
gcgaaggtgcagcaggtggagacgtggaccgtgatgggctaccacaaccacagcagtggc
atgcacagcactcagcggatgtttggctgtgagatccgggaggacggccgtaccagcagc
ttctggcagtttggctttgatgggcaggaccacgtgtcactggacctggagactctgagc
tgggtgtcagccaaacctgcggccgtgcggaccaagcgctggtgggagacagagcgctgc
tatgctgagtatgacaaggcctacctggaaggcctctgcctcatttccctgcacaggtac
ctggagctgggaggccagagcctcacccggaaagagccgcccacagtgcaggtgacaaga
cacacagcccaggatggaggcatcaccctgaaatgctgggcccggggcttctacccacgg
gacatctcattgagctggtggctgggtgaggaggagctggttctagagactgagtacgtg
gagacacgccccagtggagatggcacctaccagacatgggcagccgtgcgggtgccggcc
aggaaggaggactggtacacttgccacgtgcagcactctggcctgaaccatacgctcact
gtggcctgggaagcaccctctcatcagtggaaaaccagtgctgtggttgtctccactatc
ttcaccatcactttcttgctgatggctggagtgtggatcttcatcaagcagtactctcaa
gccaggaataaggaatcttgcaatcaagccccaggtggagaggaccctcagaattcccaa
agcccagtgacagtggaggccactcagctgctctgctga

KEGG   Ursus arctos horribilis: 113264228
Entry
113264228         CDS       T05909                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, A-3 alpha chain
  KO
K06751  MHC class I antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04145  Phagosome
uah04218  Cellular senescence
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04940  Type I diabetes mellitus
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05203  Viral carcinogenesis
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113264228
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113264228
   04145 Phagosome
    113264228
  09143 Cell growth and death
   04218 Cellular senescence
    113264228
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113264228
   04612 Antigen processing and presentation
    113264228
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113264228
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113264228
   05330 Allograft rejection
    113264228
   05332 Graft-versus-host disease
    113264228
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113264228
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113264228
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113264228
   05170 Human immunodeficiency virus 1 infection
    113264228
   05168 Herpes simplex virus 1 infection
    113264228
   05163 Human cytomegalovirus infection
    113264228
   05167 Kaposi sarcoma-associated herpesvirus infection
    113264228
   05169 Epstein-Barr virus infection
    113264228
   05165 Human papillomavirus infection
    113264228
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113264228
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113264228
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113264228
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Antigens
  113264228
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 113264228
NCBI-ProteinID: XP_026366924
UniProt: A0A3Q7XKA4
LinkDB
Position
Unknown
AA seq 378 aa
MDDNSDTLSTEKTASAWEEGGGRRTQALLRRLALTSAPLTPGSLLFSDPLALFRRPNLPR
PLPSRPPPPAPRAPRREEGRTGSQPLRARRLALPAVFGHRRVPARPRGSRLRALHAVRAV
RQRRSESRDGAAGAAGGAGGAGVLGPGDAGLRDLHTDSGGKLNEVRGHYNQSEAGSHTFQ
RMIGXWALPARAPSDAYDGADYIVPNDDLLSWTAADTAAQIARRKWEATGEAEHYGNYLD
GACVEWLRRQLENAKETLRRAEPHNTHVTXHRFSDHDVTLRCWALGFYPAEITLTWQQDG
EDLTQATEHVETRPAGDGTSQKWAAXEEQRYPCHVQHEGLPEPLTXRWELLPEPTIPTMG
IIAGLVLPAVTGAVVAGA
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggatgacaacagtgacaccctttctacagagaaaaccgcctcagcgtgggaggaggga
gggggccgccggacccaagcgctgctccgccgcctggcactcacctccgccccactcaca
cctgggtccctactcttctccgacccactggcccttttccgtcgcccgaacctccctcgc
cccctgccctcccggccgcctccacctgcgccccgggccccgcggcgggaggagggtcgg
acggggtctcagcccctccgcgcccgcaggcttgcactccctgcggtatttgggcaccgc
cgtgtcccggcccggccgcggggaagtcggctacgtgcactacacgcagttcgcgcggtt
cgacagcgacgcagcgagtcccgggatggagccgcgggcgccgcgggtggagcaggaggg
gccggagtattgggacccggagacgcgggactccgggacctgcacacagactccggaggg
aaactgaacgaagtgcgcggccactacaaccagagcgaggcagggtctcacaccttccag
agaatgataggctgatgggcgcttcctgcgcgggcaccttctgacgcctacgacggcgcg
gattacatcgtcccgaacgacgacctgctctcctggaccgcggcggacaccgcggcgcag
atcgcccggcgcaagtgggaggcgacaggtgaggctgaacactacgggaactatctggac
ggcgcgtgcgtggagtggctccgcaggcagctggagaacgcgaaggagacgctgcggcgc
gcagaaccccacaacacacatgtgaccntgcaccgcttctctgaccatgatgtcaccctg
agatgctgggctctgggcttctaccctgcggagatcaccctgacctggcagcaggatggg
gaggacctgacccaggccacagaacatgtggagaccaggcctgcgggagatgggacctcc
cagaagtgggcagccnaagaggagcagagatacccgtgccacgtgcagcatgaggggctg
cctgagcccctcacctagagatgggagctgctgcctgagcccaccatccccaccatgggc
atcattgctggcctggttctccctgcggtcacgggagctgtggtggcgggagcatga

DBGET integrated database retrieval system