KEGG   Ursus arctos horribilis: 113243726
Entry
113243726         CDS       T05909                                 

Gene name
CSNK2B
Definition
(RefSeq) casein kinase II subunit beta
  KO
K03115  casein kinase II subunit beta
Organism
uah  Ursus arctos horribilis
Pathway
uah03008  Ribosome biogenesis in eukaryotes
uah04064  NF-kappa B signaling pathway
uah04137  Mitophagy - animal
uah04310  Wnt signaling pathway
uah04520  Adherens junction
uah05010  Alzheimer disease
uah05162  Measles
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    113243726 (CSNK2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113243726 (CSNK2B)
   04064 NF-kappa B signaling pathway
    113243726 (CSNK2B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113243726 (CSNK2B)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    113243726 (CSNK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113243726 (CSNK2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113243726 (CSNK2B)
  09172 Infectious disease: viral
   05162 Measles
    113243726 (CSNK2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:uah03009]
    113243726 (CSNK2B)
   03036 Chromosome and associated proteins [BR:uah03036]
    113243726 (CSNK2B)
Ribosome biogenesis [BR:uah03009]
 Eukaryotic type
  90S particles
   Kinase
    113243726 (CSNK2B)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     113243726 (CSNK2B)
SSDB
Motif
Pfam: CK_II_beta CCDC24
Other DBs
NCBI-GeneID: 113243726
NCBI-ProteinID: XP_026338303
UniProt: A0A3Q7UQA0
LinkDB
Position
Unknown
AA seq 215 aa
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa
ttcttctgtgaagtggatgaagactacatccaggacaaattcaatctcactggactcaat
gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa
gagctggaagacaaccccaaccagagcgacctgattgagcaggcagccgagatgctttat
ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag
taccagcagggagactttggctactgtccccgtgtgtactgtgagaaccagccaatgctt
cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc
atggacgtgtacacacccaagtcatcgaggcaccatcacacggacggcgcctacttcggc
accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagcggcccgcc
aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

KEGG   Ursus arctos horribilis: 113252303
Entry
113252303         CDS       T05909                                 

Gene name
CSNK2A2
Definition
(RefSeq) casein kinase II subunit alpha' isoform X1
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah03008  Ribosome biogenesis in eukaryotes
uah04064  NF-kappa B signaling pathway
uah04137  Mitophagy - animal
uah04310  Wnt signaling pathway
uah04520  Adherens junction
uah05010  Alzheimer disease
uah05162  Measles
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    113252303 (CSNK2A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113252303 (CSNK2A2)
   04064 NF-kappa B signaling pathway
    113252303 (CSNK2A2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113252303 (CSNK2A2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    113252303 (CSNK2A2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113252303 (CSNK2A2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113252303 (CSNK2A2)
  09172 Infectious disease: viral
   05162 Measles
    113252303 (CSNK2A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113252303 (CSNK2A2)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:uah03009]
    113252303 (CSNK2A2)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113252303 (CSNK2A2)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: Other
  CK2 family
   113252303 (CSNK2A2)
Ribosome biogenesis [BR:uah03009]
 Eukaryotic type
  90S particles
   Kinase
    113252303 (CSNK2A2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal Kdo Choline_kinase ABC1
Other DBs
NCBI-GeneID: 113252303
NCBI-ProteinID: XP_026350655
UniProt: A0A3Q7VEV2
LinkDB
Position
Unknown
AA seq 345 aa
MEVAGWGCIVGIGLVNPKSWHLCVTLAFHSNQDDYQLVRKLGRGKYSEVFEAINITNNER
VVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQL
YQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHP
AQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVR
IAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKL
LRYDHQQRLTAKEAMEHPYFYPVVKEQSQPSADNAVLSSGLTAAR
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggaagtggctggatgggggtgtatagtgggcataggcttggttaatcccaagtcctgg
catttatgtgtcactcttgcctttcacagtaatcaagatgattaccaactggttcgaaaa
cttggtcggggaaagtatagtgaagtatttgaggccattaacatcaccaacaatgagaga
gtggttgtaaaaattctcaagccagtgaagaaaaagaagataaaacgagaggttaagatt
ctggagaaccttcgtggtggaacaaatatcattaagctgattgacactgtgaaggaccct
gtgtcaaagacaccagctttggtatttgaatatatcaataatacagattttaagcaactt
taccagatcctgacagacttcgatatccggttttatatgtatgagctacttaaggctctg
gattactgccacagcaagggaatcatgcacagggatgtgaaacctcacaatgtcatgata
gatcaccaacagaaaaagctgcgactgatagactggggtctggcagagttctaccatcct
gctcaggagtacaatgtccgtgtagcctcaaggtacttcaagggcccggagctcctcgtg
gactatcagatgtatgattacagcttggacatgtggagtttgggctgtatgttagcgagc
atgatctttcgaaaggagcccttctttcacggacaggacaactatgaccagcttgttcgc
attgccaaggttctgggtacagatgagctgtatgggtatctgaagaagtatcacatagac
ctagatccgcacttcaacgatatcctgggacaacattcacggaaacgctgggaaaacttt
atccatagtgagaacagacacctcgtcagccccgaggccctagatcttctggacaaactt
ctgcgatacgaccatcaacagagactgactgccaaagaggccatggagcacccgtacttc
taccccgtggtgaaggagcagtcccagccttctgcagacaatgctgtgctttccagtggc
ctcacggcagcccggtga

KEGG   Ursus arctos horribilis: 113258441
Entry
113258441         CDS       T05909                                 

Gene name
CSNK2A1
Definition
(RefSeq) casein kinase II subunit alpha
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah03008  Ribosome biogenesis in eukaryotes
uah04064  NF-kappa B signaling pathway
uah04137  Mitophagy - animal
uah04310  Wnt signaling pathway
uah04520  Adherens junction
uah05010  Alzheimer disease
uah05162  Measles
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    113258441 (CSNK2A1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113258441 (CSNK2A1)
   04064 NF-kappa B signaling pathway
    113258441 (CSNK2A1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113258441 (CSNK2A1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    113258441 (CSNK2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113258441 (CSNK2A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113258441 (CSNK2A1)
  09172 Infectious disease: viral
   05162 Measles
    113258441 (CSNK2A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113258441 (CSNK2A1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:uah03009]
    113258441 (CSNK2A1)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113258441 (CSNK2A1)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: Other
  CK2 family
   113258441 (CSNK2A1)
Ribosome biogenesis [BR:uah03009]
 Eukaryotic type
  90S particles
   Kinase
    113258441 (CSNK2A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal Kdo Choline_kinase ABC1 FTA2
Other DBs
NCBI-GeneID: 113258441
NCBI-ProteinID: XP_026358991
UniProt: A0A3Q7VCZ8
LinkDB
Position
Unknown
AA seq 391 aa
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtcgggacccgtgccaagcagggccagagtttacacagatgttaatacgcacagaccc
cgagagtactgggattatgagtcacacgtggtggagtggggtaatcaagatgactaccag
ctggttcgaaaattaggccggggtaaatacagtgaagtttttgaagccatcaacatcaca
aataatgaaaaagttgttgttaaaattctcaagccagtaaagaagaagaaaatcaagcgt
gaaataaagattttggagaatttacgaggcggtcccaatatcatcacactggcagacatt
gtaaaagaccctgtgtcacgaacccctgccttggtttttgaacacgtaaacaacacagac
ttcaagcaattgtaccagacgttaacagactatgatattcgattttacatgtatgagatt
ctgaaggccctggattattgtcacagcatgggtattatgcacagagatgtgaagccccat
aatgtcatgattgatcatgagcacagaaagctacgactaatagactggggtttggctgag
ttttaccatcctggccaagaatataatgtcagagttgcttcccgatacttcaaaggtcct
gagctactggtagactatcagatgtacgattatagtttggatatgtggagtttgggttgt
atgctggccagtatgatcttccggaaggagccatttttccatggacatgataattatgat
cagttggtgaggatagccaaggttctggggacagaagatttatatgactatattgacaaa
tacaacattgaattagacccacgtttcaatgatatcttgggcagacactcccgtaagcga
tgggaacgctttgtccacagtgaaaaccagcaccttgtcagccctgaggccttggatttc
ttggataagctgctgcgatacgaccaccagtcacggcttaccgcaagagaggccatggag
cacccctatttctatactgttgtgaaggaccaggctcgaatgggctcatctagcatgccg
gggggcagtacgcctgtcagcagcgccaatatgatgtcagggatttcttcagtgccaacc
ccttcaccccttggacctctggcaggctcaccagtgattgctgctgccaacccccttggg
atgcctgttccagctgccgctggcgctcagcagtaa

DBGET integrated database retrieval system