KEGG   Ursus arctos horribilis: 113243741
Entry
113243741         CDS       T05909                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04022  cGMP-PKG signaling pathway
uah04141  Protein processing in endoplasmic reticulum
uah04151  PI3K-Akt signaling pathway
uah04211  Longevity regulating pathway
uah04261  Adrenergic signaling in cardiomyocytes
uah04668  TNF signaling pathway
uah04728  Dopaminergic synapse
uah04911  Insulin secretion
uah04915  Estrogen signaling pathway
uah04918  Thyroid hormone synthesis
uah04925  Aldosterone synthesis and secretion
uah04926  Relaxin signaling pathway
uah04927  Cortisol synthesis and secretion
uah04928  Parathyroid hormone synthesis, secretion and action
uah04934  Cushing syndrome
uah04935  Growth hormone synthesis, secretion and action
uah05020  Prion disease
uah05030  Cocaine addiction
uah05031  Amphetamine addiction
uah05034  Alcoholism
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113243741 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    113243741 (ATF6B)
   04022 cGMP-PKG signaling pathway
    113243741 (ATF6B)
   04151 PI3K-Akt signaling pathway
    113243741 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    113243741 (ATF6B)
   04915 Estrogen signaling pathway
    113243741 (ATF6B)
   04926 Relaxin signaling pathway
    113243741 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    113243741 (ATF6B)
   04918 Thyroid hormone synthesis
    113243741 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    113243741 (ATF6B)
   04925 Aldosterone synthesis and secretion
    113243741 (ATF6B)
   04927 Cortisol synthesis and secretion
    113243741 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113243741 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    113243741 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    113243741 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113243741 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    113243741 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    113243741 (ATF6B)
   05031 Amphetamine addiction
    113243741 (ATF6B)
   05034 Alcoholism
    113243741 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113243741 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243741 (ATF6B)
   05161 Hepatitis B
    113243741 (ATF6B)
   05163 Human cytomegalovirus infection
    113243741 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113243741 (ATF6B)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    113243741 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 113243741
NCBI-ProteinID: XP_026338331
UniProt: A0A3Q7TQF7
LinkDB
Position
Unknown
AA seq 711 aa
MVGGRERKMAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDDVAEEQTQLFRCP
EQDVPFGSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPS
SQASGVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTSDDASDVQTKVEPVSPSS
SINSEASLLSAESPNQAFIGEEVLEVKTESPSPQGCLLQDVLGPPLGGVQISMGPSSDGS
LGKALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPPAPISPRMSGEQPQPRRHLLEFSTQEPIQGVEPLQGSSLGPEEPQPSTPGRP
SFRNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQLRKKSPPVKAVPTQPLGPPERDPVGQLQLYRRPDRSQPEFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSSTPGNATGGPLPASAAGQAHQASHQPLYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggcgggagagaaagatggcggaactgatgctcctcagcgagattgcggac
ccaacacgttttttcacggacaacttgctgagcccggaggactggggtctgcggaacagc
accttgtacactggcctggatgatgtggcggaggagcagacgcagctcttccgctgccca
gagcaggatgtcccgtttggcagcagctccctggatgtggggatggatgtcagcccccct
gagccaccttgggaccccctgcctatcttcccagatcttcaggtgaagtctgagccatcc
tccccctgctcctcttcctccctcagctccgaatcatcccatctttccacagagccctcc
agccaggcttctggtgtaggagaggtgctggttgtgaagacagagtccttggcaccccca
ctctgcctcctaggagatgacccaacatccccatttgaaactgtccagatcaatgtgggt
cccacctctgatgacgcctcagatgtccagaccaaggtagaacctgtctctccatcttcc
tccatcaactctgaggcttccctgctctcagcggagtcccccaaccaggcttttatagga
gaggaggtactggaagtgaagacagagtcaccgtcccctcaagggtgtctcctgcaggat
gtcctaggccccccacttggaggtgtccagatcagcatgggcccatcctctgatggctcc
ttaggcaaagcccttcccacccggaaaccacccctgcagcccaaacctgtggtgataacc
accgtcccaatgccacccagagctgtgcctcccagcaccaccatccttttgcagcccctt
gtccagccacccccagtctccccagttgtcctcatccaaggtgctattcgggtccagcct
gaggggccggcccccccggctccaaggcctgagaggaagagcattgttccagcccctatg
cctgggaactcctgcccacctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcggcctgccagtcacggaggaagaagaaggagtacctgcagggg
ctggaggctcggctgcaggccgtgctggccgacaaccagcagctccgccgggagaacgct
gccctccggcggcggctggaggccctgctggctgagaacagcgagctcaaattagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcatcgccttcaactttgga
cccgtcagcatcagtgagcctcctccggctcccatctctcctcggatgagtggagagcag
cctcagccccggagacatttgctggagttctcaacgcaagagccaattcagggagttgaa
cccctccagggttcctccctgggccctgaggagccccagcccagcactccaggccggcca
agtttcaggaacctgacagccttccccgggggtgccaaggagttgctgctgagagacctg
gaccagctcttcctctcctctgactgccggcacttcaaccgcaccgagtctctgaggctt
gctgatgagctgagtggctgggtccagcgccaccagagaggccggcggaagattcctcag
agagcccaggagagacagaagtctcagctacggaagaagtcgcctccagttaaggcagtc
cccacccaacccctggggcccccagagagggatcctgtgggccagctgcagctgtatcgc
cgcccagaccgttcgcagccagaattcctggatgcaatcgaccgacgagaagacacgttt
tatgttgtgtccttccgaagggaccacttgctgctccctgccatcagccacaacaagacc
tctcggcccaagatgtccctggtgatgcctgccatggctcccaatgagaccctgtcaggc
cggggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacggtgcccccctcactccgaaaacagccatcctcg
accccgggcaatgccacaggtggccccttgccagcttctgcagccggccaggcccaccag
gcctcccaccagcccctctacctcaatcacccctga

DBGET integrated database retrieval system