KEGG   Ursus arctos horribilis: 113243864
Entry
113243864         CDS       T05909                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04012  ErbB signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04110  Cell cycle
uah04115  p53 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04218  Cellular senescence
uah04630  Jak-STAT signaling pathway
uah04921  Oxytocin signaling pathway
uah04928  Parathyroid hormone synthesis, secretion and action
uah04934  Cushing syndrome
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05216  Thyroid cancer
uah05217  Basal cell carcinoma
uah05218  Melanoma
uah05219  Bladder cancer
uah05220  Chronic myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113243864 (CDKN1A)
   04630 Jak-STAT signaling pathway
    113243864 (CDKN1A)
   04066 HIF-1 signaling pathway
    113243864 (CDKN1A)
   04068 FoxO signaling pathway
    113243864 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    113243864 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113243864 (CDKN1A)
   04115 p53 signaling pathway
    113243864 (CDKN1A)
   04218 Cellular senescence
    113243864 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    113243864 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    113243864 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243864 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    113243864 (CDKN1A)
   05206 MicroRNAs in cancer
    113243864 (CDKN1A)
   05205 Proteoglycans in cancer
    113243864 (CDKN1A)
   05203 Viral carcinogenesis
    113243864 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113243864 (CDKN1A)
   05212 Pancreatic cancer
    113243864 (CDKN1A)
   05225 Hepatocellular carcinoma
    113243864 (CDKN1A)
   05226 Gastric cancer
    113243864 (CDKN1A)
   05214 Glioma
    113243864 (CDKN1A)
   05216 Thyroid cancer
    113243864 (CDKN1A)
   05220 Chronic myeloid leukemia
    113243864 (CDKN1A)
   05217 Basal cell carcinoma
    113243864 (CDKN1A)
   05218 Melanoma
    113243864 (CDKN1A)
   05211 Renal cell carcinoma
    113243864 (CDKN1A)
   05219 Bladder cancer
    113243864 (CDKN1A)
   05215 Prostate cancer
    113243864 (CDKN1A)
   05213 Endometrial cancer
    113243864 (CDKN1A)
   05224 Breast cancer
    113243864 (CDKN1A)
   05222 Small cell lung cancer
    113243864 (CDKN1A)
   05223 Non-small cell lung cancer
    113243864 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113243864 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243864 (CDKN1A)
   05161 Hepatitis B
    113243864 (CDKN1A)
   05160 Hepatitis C
    113243864 (CDKN1A)
   05163 Human cytomegalovirus infection
    113243864 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243864 (CDKN1A)
   05169 Epstein-Barr virus infection
    113243864 (CDKN1A)
   05165 Human papillomavirus infection
    113243864 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    113243864 (CDKN1A)
   01522 Endocrine resistance
    113243864 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113243864
NCBI-ProteinID: XP_026338555
UniProt: A0A3Q7UEB0
LinkDB
Position
Unknown
AA seq 164 aa
MAEPSGDAQQVPRGSKACRRLFGPVDSEQLRRDCDALMAGCVQEARERWNFDFVTETPLE
GDFAWERVWGLGLPKLYLPAGPWGGRDDLGGGKRPSPSPALLQGTAQEDHLDLSLSCTLM
PHAPERPEASPGAPGTSQGRRRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcggagccgtccggggacgcccagcaggtcccgcgtggcagcaaggcttgccgccgc
ctcttcggccccgtggacagcgagcagctgcgccgagactgcgatgcgctgatggcgggc
tgcgtgcaggaggccagggagcgatggaacttcgacttcgtcaccgagacaccgctggag
ggcgactttgcctgggagcgcgtgtggggcctgggcctgcccaagctctacctgcctgca
gggccctgggggggccgggatgacctgggagggggcaagcggcccagcccctcgcctgcc
ctgctgcaggggaccgctcaggaggaccacctggacctgtcgctgtcctgcaccctcatg
cctcacgcccctgagcggcccgaggcgtccccgggggctcctggcacctctcagggccgg
agacggcggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctcc
aaaaggaagccctga

DBGET integrated database retrieval system