KEGG   Ursus arctos horribilis: 113243955
Entry
113243955         CDS       T05909                                 

Gene name
LSP1
Definition
(RefSeq) lymphocyte-specific protein 1 isoform X1
  KO
K14957  lymphocyte-specific protein 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04625  C-type lectin receptor signaling pathway
uah05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113243955 (LSP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113243955 (LSP1)
SSDB
Motif
Pfam: Caldesmon
Other DBs
NCBI-GeneID: 113243955
NCBI-ProteinID: XP_026338687
UniProt: A0A3Q7VL43
LinkDB
Position
Unknown
AA seq 369 aa
MAEAPSPPSSEEQEGLLADKDAGLTTQWSVEDEEEAARERRRRERDRQLRDQDEDGGGQC
PELPEQETLLSLKPSEAPELDEDEGFSDWSQKPEQRRQHWGAGETSNCGEPPWGESPEGQ
QEEDRPHQHARENRDGDEQSPAGVCLEALHLSPSSEPQEGPGTEETEPKSPEGTIRGSLG
PAEAGEAAEQVHQKRQQPRTPSPLVLEGTTEPDSPPLSPSTKLIDRTESLNRSIKKSNSV
KKSQPALPISKIDERLEQYTQAIEWALSPLQTAGRTSKLARQPSIELPSMAVASTKSRWE
TGEVQAQSTAKAPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKQSTPSGKRYKFVATGHGK
YEKVLVDES
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcggaggctcccagcccccccagctccgaggagcaggaagggctgctggcggacaaa
gatgccgggctcaccactcagtggagtgtggaagatgaggaggaggccgccagggagcgg
cgccgccgggagagggaccggcagctgcgggaccaggacgaggacggcggtggccagtgc
cccgagctgcccgagcaggagaccctcctcagcctgaagccctcagaggctcctgaactg
gacgaagatgagggtttcagcgactggtcccagaagccagagcagcggcgacagcactgg
ggggccggggagacctccaactgcggggagcccccatggggcgagagtccggaggggcag
caggaggaggacaggccccaccagcacgcccgtgagaaccgggacggtgatgagcagagc
ccagccggagtctgcctggaggcactgcatctgagccccagctcagagccccaggagggg
ccagggacagaggagacagagcccaagagcccagaggggaccatccggggcagcctggga
cccgcagaagccggggaggccgctgagcaggtgcaccagaaacgccagcagcccaggaca
cccagccccctggtcttggagggcaccactgaaccagattcgcctcccctgagccccagc
accaaactcatcgacagaaccgagtctctgaaccgctccatcaagaagagtaacagtgtg
aagaagtcccagccagccctgcccatctccaagattgatgagcggctggagcagtacacc
caggccattgagtgggctctttctcctctgcagactgctggccggacctccaagttagcc
cgccagccctccattgagctgcccagcatggccgtggcaagcaccaagagccggtgggaa
acaggagaggtgcaggctcagtccactgccaaggccccctcctgcaaggatattgtagct
ggagacatgagcaagaaaagcctctgggagcagaaaggaggctccaagacatcatcaaca
attaagcagagtaccccatctggaaagaggtacaagtttgtggccactggacacgggaag
tatgagaaggtgctcgtggatgagagctag

DBGET integrated database retrieval system