KEGG   Ursus arctos horribilis: 113243982
Entry
113243982         CDS       T05909                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04068  FoxO signaling pathway
uah04110  Cell cycle
uah04115  p53 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04218  Cellular senescence
uah04310  Wnt signaling pathway
uah04340  Hedgehog signaling pathway
uah04371  Apelin signaling pathway
uah04390  Hippo signaling pathway
uah04510  Focal adhesion
uah04530  Tight junction
uah04630  Jak-STAT signaling pathway
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04921  Oxytocin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04934  Cushing syndrome
uah05160  Hepatitis C
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05216  Thyroid cancer
uah05218  Melanoma
uah05219  Bladder cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113243982 (CCND1)
   04340 Hedgehog signaling pathway
    113243982 (CCND1)
   04390 Hippo signaling pathway
    113243982 (CCND1)
   04371 Apelin signaling pathway
    113243982 (CCND1)
   04630 Jak-STAT signaling pathway
    113243982 (CCND1)
   04068 FoxO signaling pathway
    113243982 (CCND1)
   04151 PI3K-Akt signaling pathway
    113243982 (CCND1)
   04152 AMPK signaling pathway
    113243982 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113243982 (CCND1)
   04115 p53 signaling pathway
    113243982 (CCND1)
   04218 Cellular senescence
    113243982 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113243982 (CCND1)
   04530 Tight junction
    113243982 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    113243982 (CCND1)
   04921 Oxytocin signaling pathway
    113243982 (CCND1)
   04919 Thyroid hormone signaling pathway
    113243982 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243982 (CCND1)
   05206 MicroRNAs in cancer
    113243982 (CCND1)
   05205 Proteoglycans in cancer
    113243982 (CCND1)
   05203 Viral carcinogenesis
    113243982 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113243982 (CCND1)
   05212 Pancreatic cancer
    113243982 (CCND1)
   05225 Hepatocellular carcinoma
    113243982 (CCND1)
   05226 Gastric cancer
    113243982 (CCND1)
   05214 Glioma
    113243982 (CCND1)
   05216 Thyroid cancer
    113243982 (CCND1)
   05221 Acute myeloid leukemia
    113243982 (CCND1)
   05220 Chronic myeloid leukemia
    113243982 (CCND1)
   05218 Melanoma
    113243982 (CCND1)
   05219 Bladder cancer
    113243982 (CCND1)
   05215 Prostate cancer
    113243982 (CCND1)
   05213 Endometrial cancer
    113243982 (CCND1)
   05224 Breast cancer
    113243982 (CCND1)
   05222 Small cell lung cancer
    113243982 (CCND1)
   05223 Non-small cell lung cancer
    113243982 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113243982 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113243982 (CCND1)
   04934 Cushing syndrome
    113243982 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113243982 (CCND1)
   05162 Measles
    113243982 (CCND1)
   05160 Hepatitis C
    113243982 (CCND1)
   05163 Human cytomegalovirus infection
    113243982 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243982 (CCND1)
   05169 Epstein-Barr virus infection
    113243982 (CCND1)
   05165 Human papillomavirus infection
    113243982 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113243982 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 113243982
NCBI-ProteinID: XP_026338757
UniProt: A0A3Q7VLB8
LinkDB
Position
Unknown
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEESRQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSNSFLSYHRLTRFLSKVIKCD
ADCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEADLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccaactcttatgctgcgaagtggagaccatccgccgggcgtaccccgatgcc
aacctactcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcaccc
tccgtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagaccatccccctgacg
gccgaaaagctgtgcatctacactgacaactccatccggcctgacgagctgctgcaaatg
gagctgctcctggtgaacaaactcaagtggaacctggccgcgatgaccccgcacgatttc
attgagcacttcctctccaagatgccagtggccgaggagagcagacagatcatccggaag
catgctcagaccttcgtcgccctctgtgccacagacgtgaagttcatttccaacccgccc
tccatggtggcagccgggagtgtggtggccgccgtgcagggcctgcacctgggaagttcc
aacagcttcctgtcctaccaccgcctcactcggttcctctccaaagtgattaagtgcgac
gcggactgtctccgggcatgccaggagcagatcgaagccctgctggagtccagcctgcgc
caggcccagcagcagagcctggaccccaaggccgccgaggaggaggaggaggaggaggag
gccgacctggcctgcacgcccaccgacgtgcgagacgtgaacatttga

KEGG   Ursus arctos horribilis: 113244704
Entry
113244704         CDS       T05909                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
uah  Ursus arctos horribilis
Pathway
uah04110  Cell cycle
uah04114  Oocyte meiosis
uah04115  p53 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04218  Cellular senescence
uah04934  Cushing syndrome
uah05161  Hepatitis B
uah05162  Measles
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05206  MicroRNAs in cancer
uah05215  Prostate cancer
uah05222  Small cell lung cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113244704 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113244704 (CCNE1)
   04114 Oocyte meiosis
    113244704 (CCNE1)
   04115 p53 signaling pathway
    113244704 (CCNE1)
   04218 Cellular senescence
    113244704 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113244704 (CCNE1)
   05206 MicroRNAs in cancer
    113244704 (CCNE1)
   05203 Viral carcinogenesis
    113244704 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    113244704 (CCNE1)
   05215 Prostate cancer
    113244704 (CCNE1)
   05222 Small cell lung cancer
    113244704 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113244704 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113244704 (CCNE1)
   05162 Measles
    113244704 (CCNE1)
   05161 Hepatitis B
    113244704 (CCNE1)
   05169 Epstein-Barr virus infection
    113244704 (CCNE1)
   05165 Human papillomavirus infection
    113244704 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:uah03032]
    113244704 (CCNE1)
   03036 Chromosome and associated proteins [BR:uah03036]
    113244704 (CCNE1)
DNA replication proteins [BR:uah03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    113244704 (CCNE1)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    113244704 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C CBM_1 Connexin50
Other DBs
NCBI-GeneID: 113244704
NCBI-ProteinID: XP_026340033
UniProt: A0A3Q7UUZ5
LinkDB
Position
Unknown
AA seq 410 aa
MPRERRERDAKERDTMKEESGTDVSVRSRKRKANVAVFLQDPDEEIAKIDRTVRSQCGSQ
PWDGNSVCENPCSLIPTPDKEEDEPASPSSTCAPQSFMPSRASPLPILNWANRDEVWKIM
LNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGEEILSMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDLYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFPYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQAKKAILSEQNRISPLPTGVLTPPQSSKKQSSEQGTA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagaggagggagagggatgcgaaggaacgggacaccatgaaggaggaaagt
ggcaccgatgtctctgttcgctccaggaaaaggaaggcaaatgtggctgttttcttgcag
gatccagatgaagagattgcaaaaattgacaggactgtgagaagccagtgcggcagtcag
ccttgggacggcaattctgtgtgtgaaaacccctgctccttgattcccacacctgacaaa
gaagaggatgagccggcatccccaagttccacgtgtgcaccgcagagtttcatgccctcc
agagcctcaccactgcctatactgaactgggcaaatagagatgaggtctggaaaattatg
ctaaacaaggaaaagacatacttacgggataagcactttatgcagcggcatcctctcctg
cagcctaagatgcgagcgattcttctggattggttaatggaggtgtgcgaagtctataaa
cttcacagagaaacattttacttggcacaggatttctttgatcggtatatggcaacacaa
caaaatattgtaaaaacacttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctaccctccaaagctacaccagttcgcttatgttacggacggggct
tgttcaggagaggagattctcagcatggaattaatcattatgaaggcccttaagtggcac
ttaagtcccctgaccatcgtgtcctggctgaatgtatatatgcaggttgcgtatctaaac
gacttgtatgaagtgctcctgccacagtatccccagcagatcttcatacagatcgcagag
cttttagatctctgtgtcctggacgtcggctgcttagaatttccctatggtgtccttgct
gcttctgccttgtatcatttctcttcctctgagttgatgcaaaaggtttcagggtatcag
tggtgcgatatagagaagtgtgtcaagtggatggttccatttgccatggttataagggag
acaggaagctcgaagctgaagcacttcaggggggttcctgctgaagacgcgcacaacatc
cagacgcacatcaacagcttggacttgctggacaaagcccaagcaaagaaagccatattg
tctgaacaaaataggatttctcctctccccaccggggtcctcactcccccacagagcagt
aagaagcagagcagtgagcaggggacagcgtga

KEGG   Ursus arctos horribilis: 113252919
Entry
113252919         CDS       T05909                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
uah  Ursus arctos horribilis
Pathway
uah04110  Cell cycle
uah04114  Oocyte meiosis
uah04115  p53 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04218  Cellular senescence
uah04934  Cushing syndrome
uah05161  Hepatitis B
uah05162  Measles
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05206  MicroRNAs in cancer
uah05215  Prostate cancer
uah05222  Small cell lung cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113252919 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113252919 (CCNE2)
   04114 Oocyte meiosis
    113252919 (CCNE2)
   04115 p53 signaling pathway
    113252919 (CCNE2)
   04218 Cellular senescence
    113252919 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113252919 (CCNE2)
   05206 MicroRNAs in cancer
    113252919 (CCNE2)
   05203 Viral carcinogenesis
    113252919 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    113252919 (CCNE2)
   05215 Prostate cancer
    113252919 (CCNE2)
   05222 Small cell lung cancer
    113252919 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113252919 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113252919 (CCNE2)
   05162 Measles
    113252919 (CCNE2)
   05161 Hepatitis B
    113252919 (CCNE2)
   05169 Epstein-Barr virus infection
    113252919 (CCNE2)
   05165 Human papillomavirus infection
    113252919 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:uah03032]
    113252919 (CCNE2)
   03036 Chromosome and associated proteins [BR:uah03036]
    113252919 (CCNE2)
DNA replication proteins [BR:uah03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    113252919 (CCNE2)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    113252919 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 113252919
NCBI-ProteinID: XP_026351488
UniProt: A0A3Q7VR74
LinkDB
Position
Unknown
AA seq 404 aa
MSRRSSRLQAKQQSQPNQTDSPQEAQIIQAKKRKTAQDVKKRKEEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKDVWLNMLKK
ETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDNISECVDWMVPFVSVVKSTSPVKLKIFKKISMEDRHNIQTH
TNYLAMLDEVNYVNTFRKGGQLSPVCSGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcaacagtcccagcccaaccagacggat
tccccccaagaagcccagataattcaggccaagaagagaaaaacagctcaggatgtcaaa
aaaagaaaagaggaggtcaccaagaaacatcagtatgagattaggaattgttggccacct
gtattatctggggggatcagtccttgtattatcattgaaacaccccacaaggaaatagga
acaagtgacttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagttggggatgttcaaaggatgtttggctaaacatgctaaaaaaa
gagaccagatatgttcatgacaaacattttgaagttctgcattctgacttggaaccacag
atgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcataga
gaaacattttaccttgcgcaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcatcgcttctaaacttgag
gaaatatatgctcctaagctccaagagtttgcttatgtcactgatggtgcctgcagtgaa
gaggatatcttaagaatggaacttattatattaaaggctttaaaatgggaactctgtcct
gtaacagtcatctcctggctaaatctcttcctccaagttgatgctcttaaagatgctccg
aaagttcttctacctcagtattctcaggaaaagttcattcaaatagctcagcttttagat
ctgtgtattctagctatcgactcattagagttccagtacagaatattggctgccgctgcc
ttgtgccattttacctctattgaagtggttaagaaagcctcaggtttggaatgggacaac
atttctgaatgcgtagactggatggtgccttttgtcagtgtagtaaaaagtactagtccc
gtgaagctgaagatttttaagaagatttctatggaagatagacacaatatccagacccat
acaaattatctggctatgctggatgaagtaaattacgtaaacaccttcagaaaaggagga
cagttgtcaccagtgtgcagtggaggcattatgaccccaccgaagagcactgaaaaacca
ccaggaaaacactaa

KEGG   Ursus arctos horribilis: 113258003
Entry
113258003         CDS       T05909                                 

Gene name
CCND2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
uah  Ursus arctos horribilis
Pathway
uah04068  FoxO signaling pathway
uah04110  Cell cycle
uah04115  p53 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04218  Cellular senescence
uah04310  Wnt signaling pathway
uah04340  Hedgehog signaling pathway
uah04390  Hippo signaling pathway
uah04510  Focal adhesion
uah04630  Jak-STAT signaling pathway
uah04917  Prolactin signaling pathway
uah05162  Measles
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05203  Viral carcinogenesis
uah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113258003 (CCND2)
   04340 Hedgehog signaling pathway
    113258003 (CCND2)
   04390 Hippo signaling pathway
    113258003 (CCND2)
   04630 Jak-STAT signaling pathway
    113258003 (CCND2)
   04068 FoxO signaling pathway
    113258003 (CCND2)
   04151 PI3K-Akt signaling pathway
    113258003 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113258003 (CCND2)
   04115 p53 signaling pathway
    113258003 (CCND2)
   04218 Cellular senescence
    113258003 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113258003 (CCND2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    113258003 (CCND2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113258003 (CCND2)
   05202 Transcriptional misregulation in cancer
    113258003 (CCND2)
   05206 MicroRNAs in cancer
    113258003 (CCND2)
   05203 Viral carcinogenesis
    113258003 (CCND2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113258003 (CCND2)
   05162 Measles
    113258003 (CCND2)
   05169 Epstein-Barr virus infection
    113258003 (CCND2)
   05165 Human papillomavirus infection
    113258003 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 113258003
NCBI-ProteinID: XP_026358433
UniProt: A0A3Q7WA78
LinkDB
Position
Unknown
AA seq 289 aa
MELLCCEVDPVRRAVPDANLLYDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQPSEKLSLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEDVSSLTGDALVDLLAKITNTDV
DCLKACQEQIEVVLLNSLQQFRQDQGDGSKSEDELDQASTPTDVRDIDL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagttgctgtgctgcgaggtggacccggtccgcagggccgtgccagacgccaacctg
ctctacgatgaccgcgttttgcagaacttgctcaccatcgaggagcgctaccttccccag
tgctcctacttcaaatgcgtgcagaaggacatccagccctacatgcgtaggatggtggcc
acctggatgctggaggtctgcgaggaacagaagtgcgaggaggaggtcttccctttggcc
atgaattacctggaccgcttcttggctggggtcccaactcctaagacccatctgcagctc
ctgggtgctgtctgcatgttcctggcctccaagctcaaagagaccatccctctgaccgca
gagaagttgtgcatttatactgacaactccatcaagcctcaggagctgctggagtgggag
ctggtggtgctggggaaattgaagtggaacctggcggccgtcactcctcacgacttcatc
gagcacatccttcgtaagctgccccagccgagcgagaagctgtctctgatccgcaagcac
gcgcagaccttcattgctctgtgtgccactgattttaagttcgccatgtacccgccatcg
atgattgcaactggaagtgtgggagctgccatctgtgggctccagcaggatgaggatgtg
agctcgctcactggcgatgccctggtcgatctgctggccaagatcaccaacacggatgtg
gactgcctcaaagcctgccaggagcagattgaggtggtgctgctcaacagcctgcagcag
ttccgtcaggaccagggggacgggtccaagtcggaggatgaactggaccaggccagcacc
cctacggacgtgcgggatattgacctgtga

KEGG   Ursus arctos horribilis: 113261302
Entry
113261302         CDS       T05909                                 

Gene name
CCND3
Definition
(RefSeq) G1/S-specific cyclin-D3 isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
uah  Ursus arctos horribilis
Pathway
uah04110  Cell cycle
uah04115  p53 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04218  Cellular senescence
uah04310  Wnt signaling pathway
uah04390  Hippo signaling pathway
uah04510  Focal adhesion
uah04630  Jak-STAT signaling pathway
uah05162  Measles
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113261302 (CCND3)
   04390 Hippo signaling pathway
    113261302 (CCND3)
   04630 Jak-STAT signaling pathway
    113261302 (CCND3)
   04151 PI3K-Akt signaling pathway
    113261302 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113261302 (CCND3)
   04115 p53 signaling pathway
    113261302 (CCND3)
   04218 Cellular senescence
    113261302 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113261302 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261302 (CCND3)
   05203 Viral carcinogenesis
    113261302 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113261302 (CCND3)
   05162 Measles
    113261302 (CCND3)
   05164 Influenza A
    113261302 (CCND3)
   05169 Epstein-Barr virus infection
    113261302 (CCND3)
   05165 Human papillomavirus infection
    113261302 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 113261302
NCBI-ProteinID: XP_026363244
UniProt: A0A3Q7X9W4
LinkDB
Position
Unknown
AA seq 292 aa
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHSVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSTSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREAAQPSPSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagctcctgtgctgcgagggcacccggcacgcgccccgggccgggccggacccgcga
ctgctgggggaccagcgtgtcctgcagagcttgctccgcctggaggagcgctacgtgccc
cgcgcctcctacttccagtgtgtgcagagggagatcaagccgcacatgcggaagatgctg
gcgtattggatgctggaggtctgtgaggagcagcgctgtgaggaggaagtcttccccctg
gccatgaactacctggatcgctacctgtcctgcgtccccacccgaaaggcgcagttgcag
ctcctgggtgcggtctgcatgctgctggcctccaagctgcgcgagacgacgcccctgacc
atcgaaaaattgtgcatctacaccgaccactctgtctctccccgccagctgcgggactgg
gaggtgctggtcctggggaagctcaagtgggacctggctgctgtgattgcccatgatttc
ctggccctgattctgcaccggctctctctgccccgtgaccgacaagctttggtcaaaaaa
catgcccagacctttttggccctctgtgctacagattacacctttgccatgtacccgcca
tccatgatcgccacgggcagcattggggcagcagtacaaggcctcggtgcgtgttccaca
tccggggatgaactcacggagctgctggcagggatcacaggcactgaggtggactgcctg
cgggcctgtcaggagcagatcgaagctgcgctcagggagagcctcagagaagccgcccag
ccctcgcctagcccggcacccaaagcccccaggggctccagtagccaggggcccagccag
accagcactcccacagatgtcacagccatccatctgtag

DBGET integrated database retrieval system