KEGG   Ursus arctos horribilis: 113244102
Entry
113244102         CDS       T05909                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
uah  Ursus arctos horribilis
Pathway
uah01523  Antifolate resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
uah04066  HIF-1 signaling pathway
uah04071  Sphingolipid signaling pathway
uah04137  Mitophagy - animal
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04218  Cellular senescence
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04917  Prolactin signaling pathway
uah04920  Adipocytokine signaling pathway
uah04926  Relaxin signaling pathway
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05010  Alzheimer disease
uah05030  Cocaine addiction
uah05132  Salmonella infection
uah05133  Pertussis
uah05134  Legionellosis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05203  Viral carcinogenesis
uah05212  Pancreatic cancer
uah05215  Prostate cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113244102 (RELA)
   04010 MAPK signaling pathway
    113244102 (RELA)
   04064 NF-kappa B signaling pathway
    113244102 (RELA)
   04668 TNF signaling pathway
    113244102 (RELA)
   04066 HIF-1 signaling pathway
    113244102 (RELA)
   04071 Sphingolipid signaling pathway
    113244102 (RELA)
   04024 cAMP signaling pathway
    113244102 (RELA)
   04151 PI3K-Akt signaling pathway
    113244102 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113244102 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    113244102 (RELA)
   04218 Cellular senescence
    113244102 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113244102 (RELA)
   04621 NOD-like receptor signaling pathway
    113244102 (RELA)
   04622 RIG-I-like receptor signaling pathway
    113244102 (RELA)
   04623 Cytosolic DNA-sensing pathway
    113244102 (RELA)
   04625 C-type lectin receptor signaling pathway
    113244102 (RELA)
   04660 T cell receptor signaling pathway
    113244102 (RELA)
   04658 Th1 and Th2 cell differentiation
    113244102 (RELA)
   04659 Th17 cell differentiation
    113244102 (RELA)
   04657 IL-17 signaling pathway
    113244102 (RELA)
   04662 B cell receptor signaling pathway
    113244102 (RELA)
   04062 Chemokine signaling pathway
    113244102 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113244102 (RELA)
   04917 Prolactin signaling pathway
    113244102 (RELA)
   04926 Relaxin signaling pathway
    113244102 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113244102 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113244102 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    113244102 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113244102 (RELA)
   05202 Transcriptional misregulation in cancer
    113244102 (RELA)
   05203 Viral carcinogenesis
    113244102 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113244102 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    113244102 (RELA)
   05221 Acute myeloid leukemia
    113244102 (RELA)
   05220 Chronic myeloid leukemia
    113244102 (RELA)
   05215 Prostate cancer
    113244102 (RELA)
   05222 Small cell lung cancer
    113244102 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113244102 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113244102 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    113244102 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113244102 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113244102 (RELA)
   04931 Insulin resistance
    113244102 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113244102 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113244102 (RELA)
   05135 Yersinia infection
    113244102 (RELA)
   05133 Pertussis
    113244102 (RELA)
   05134 Legionellosis
    113244102 (RELA)
   05152 Tuberculosis
    113244102 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113244102 (RELA)
   05170 Human immunodeficiency virus 1 infection
    113244102 (RELA)
   05162 Measles
    113244102 (RELA)
   05164 Influenza A
    113244102 (RELA)
   05161 Hepatitis B
    113244102 (RELA)
   05160 Hepatitis C
    113244102 (RELA)
   05168 Herpes simplex virus 1 infection
    113244102 (RELA)
   05163 Human cytomegalovirus infection
    113244102 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113244102 (RELA)
   05169 Epstein-Barr virus infection
    113244102 (RELA)
   05165 Human papillomavirus infection
    113244102 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113244102 (RELA)
   05145 Toxoplasmosis
    113244102 (RELA)
   05140 Leishmaniasis
    113244102 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    113244102 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    113244102 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113244102 (RELA)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    113244102 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 113244102
NCBI-ProteinID: XP_026339000
UniProt: A0A3Q7UFL2
LinkDB
Position
Unknown
AA seq 539 aa
MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTPSVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGQIPNQTSALAPAPAPILAQAPAPAPAPILAPGLAQAVVPPAPKTTQAGE
GTLSEALLHLQFDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGVSVAPHTAEPM
LMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggacgacctgtttcccctcatcttcccgtctgagcccgcccaggcctctggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc
cgctcagcgggcagtatcccgggcgagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacactgggccagggacagttcgcatctccctggttaccaaggac
ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat
gaggctgagctctgccccgaccgttgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaacaacaatccc
ttccaagttcccatcgaagaacagcgtggggactacgacctgaatgcggtgcggctgtgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgtcacctgtcctctct
catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac
cggaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacatcgaagtgtatttcacgggaccgggctgggaggcccgaggctccttttct
caagctgacgtccaccgacaagtggccattgtgttccggacacctccctacgcggacccc
agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc
agcgagcccatggaattccagtacttgccagacacagatgatcgacaccgaattgaggag
aaacgcaaaaggacgtatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga
cccaccgacccccgacctccaccccggcgcattgctgtgccttcccgaagcacaccttcc
gtccccaagccagctccccagccctatccctttacgccgtccctcagcaccatcaacttc
gaggagttctcccccatggtctttccttcggggcagatcccaaaccagacctctgccttg
gccccagcccctgccccaatcctcgcccaggccccggccccagcccctgccccgatctta
gccccaggccttgctcaggctgtggtcccccccgcccccaagaccacccaggccggggaa
gggacactgtcagaggccctgctgcacctgcagtttgacgccgacgaagacctgggggcc
ctgctgggcaacagcactgaccccgccgtgttcacagacctggcatctgtcgacaactct
gagtttcagcagctgctgaaccagggtgtatctgtggccccccacacagccgagcccatg
ctgatggagtaccctgaggcaataacgcgcctggtgacagggtcccagaggccccctgac
ccagctcctgctcccctgggggcctctgggctccccaacggcctcctctcaggggatgaa
gacttctcctccattgcagacatggacttctcagcccttctgagtcagatcagctcctaa

KEGG   Ursus arctos horribilis: 113263101
Entry
113263101         CDS       T05909                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor NF-kappa-B p105 subunit isoform X1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
uah  Ursus arctos horribilis
Pathway
uah01523  Antifolate resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
uah04066  HIF-1 signaling pathway
uah04071  Sphingolipid signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04218  Cellular senescence
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04917  Prolactin signaling pathway
uah04920  Adipocytokine signaling pathway
uah04926  Relaxin signaling pathway
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05010  Alzheimer disease
uah05030  Cocaine addiction
uah05132  Salmonella infection
uah05133  Pertussis
uah05134  Legionellosis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05203  Viral carcinogenesis
uah05206  MicroRNAs in cancer
uah05212  Pancreatic cancer
uah05215  Prostate cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113263101 (NFKB1)
   04010 MAPK signaling pathway
    113263101 (NFKB1)
   04064 NF-kappa B signaling pathway
    113263101 (NFKB1)
   04668 TNF signaling pathway
    113263101 (NFKB1)
   04066 HIF-1 signaling pathway
    113263101 (NFKB1)
   04071 Sphingolipid signaling pathway
    113263101 (NFKB1)
   04024 cAMP signaling pathway
    113263101 (NFKB1)
   04151 PI3K-Akt signaling pathway
    113263101 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113263101 (NFKB1)
   04218 Cellular senescence
    113263101 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113263101 (NFKB1)
   04621 NOD-like receptor signaling pathway
    113263101 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    113263101 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    113263101 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    113263101 (NFKB1)
   04660 T cell receptor signaling pathway
    113263101 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    113263101 (NFKB1)
   04659 Th17 cell differentiation
    113263101 (NFKB1)
   04657 IL-17 signaling pathway
    113263101 (NFKB1)
   04662 B cell receptor signaling pathway
    113263101 (NFKB1)
   04062 Chemokine signaling pathway
    113263101 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113263101 (NFKB1)
   04917 Prolactin signaling pathway
    113263101 (NFKB1)
   04926 Relaxin signaling pathway
    113263101 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113263101 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113263101 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    113263101 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113263101 (NFKB1)
   05202 Transcriptional misregulation in cancer
    113263101 (NFKB1)
   05206 MicroRNAs in cancer
    113263101 (NFKB1)
   05203 Viral carcinogenesis
    113263101 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113263101 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    113263101 (NFKB1)
   05221 Acute myeloid leukemia
    113263101 (NFKB1)
   05220 Chronic myeloid leukemia
    113263101 (NFKB1)
   05215 Prostate cancer
    113263101 (NFKB1)
   05222 Small cell lung cancer
    113263101 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113263101 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113263101 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    113263101 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113263101 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113263101 (NFKB1)
   04931 Insulin resistance
    113263101 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113263101 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113263101 (NFKB1)
   05135 Yersinia infection
    113263101 (NFKB1)
   05133 Pertussis
    113263101 (NFKB1)
   05134 Legionellosis
    113263101 (NFKB1)
   05152 Tuberculosis
    113263101 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113263101 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    113263101 (NFKB1)
   05162 Measles
    113263101 (NFKB1)
   05164 Influenza A
    113263101 (NFKB1)
   05161 Hepatitis B
    113263101 (NFKB1)
   05160 Hepatitis C
    113263101 (NFKB1)
   05168 Herpes simplex virus 1 infection
    113263101 (NFKB1)
   05163 Human cytomegalovirus infection
    113263101 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113263101 (NFKB1)
   05169 Epstein-Barr virus infection
    113263101 (NFKB1)
   05165 Human papillomavirus infection
    113263101 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113263101 (NFKB1)
   05145 Toxoplasmosis
    113263101 (NFKB1)
   05140 Leishmaniasis
    113263101 (NFKB1)
   05142 Chagas disease (American trypanosomiasis)
    113263101 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    113263101 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113263101 (NFKB1)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    113263101 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Other DBs
NCBI-GeneID: 113263101
NCBI-ProteinID: XP_026365430
UniProt: A0A3Q7WK08
LinkDB
Position
Unknown
AA seq 972 aa
MAEDDTYLGGHEQMFHLDPLTHTIFNPELFQPEMALPTADGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNTHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACTKGYNPGLLVHPDLAYLQA
EGGGDRQLTDREKEIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFGDF
SPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGAGGTGPGYGFPHYGFPTYGGITFH
PGTTKSNAGMKHGTINTLSKNDSEGCGKSVDREAVNLSGKVTEPTERDKESSSGDDEITL
TYTVGVKEENSRFHDNLFLQKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENG
DSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEAVVDDLLR
AGADLSLLDRAGNSVLHLAAKEGQDKILSILLKHKKAAPLMDHPNGEGLNAIHLAVMSDS
MPCLLLLVAAGADVNAQERKSGRTALHLAVERDNISLAGCLLLEGDAHVDSTTYDGTTAL
HIAAGRGSTRLAALLKAAGADPLVENFEPLYELDDSWDKDGEDEGVVPGTTPLDMATNWQ
VFDILNGKPYEPEFTSDDLLAQGDMKQLTEEAKLQLYKLLEIPDPDKNWATLAQKLGLGI
LNNAFRLSPAPSKTLMDNYEVSGGTIRELVEALRQMGYTEAIEVIQAAFCTPGSVAPGPG
KAIPQTLSLPLSPASTRSPLDEVRDDSICDSGVETSFRKLSFTESLTSGSSLLTLNKVPH
EYGQEGPIEGKI
NT seq 2919 nt   +upstreamnt  +downstreamnt
atggcagaagacgatacgtatttgggagggcatgaacaaatgtttcatttggatcctttg
actcatacaatatttaatccagaattatttcaaccagaaatggcactacctacagcagat
ggtccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgta
tgtgaaggcccgtcccatggtggactccccggtgcatctagtgaaaagaacaagaagtcc
taccctcaggtcaaaatctgcaactatgtgggacctgcaaaggtcattgtccagttggtc
acaaatgggaaaaacacccacctgcatgcacacagcctggtgggaaaacactgtgaggac
gggatctgcactgtaactgccggacccaaggacatggtggtcggctttgcaaacttgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacggatgacagaggca
tgtacgaagggctacaatcccggacttttggtgcaccctgatctggcttacttgcaagcg
gaaggcggaggagaccggcagctcacagatcgggaaaaggagatcatccgccaggcagct
cttcagcagacgaaggagatggacctcagcgtggtgcggctcatgtttacagcttttctt
ccagacagcaccggcagcttcacgaggcgcctggagcccgtggtgtcagacgccatctac
gacagcaaagcccccaatgcgtccaacttgaaaattgtaagaatggacaggacagctgga
tgcgtaaccggaggggaagagatttatcttctctgtgacaaggttcagaaagatgacatc
cagattcgattttacgaagaggaggaaaatggtgggatctgggaaggatttggagatttt
tcccccacagatgttcatagacaattcgccatcgtcttcaaaactccaaagtataaagat
gtcaacatcacaaaaccagcttccgtgtttgtccagcttcggaggaaatctgatctggaa
accagcgaacccaaaccttttctctactaccctgaaatcaaagataaagaggaagtgcag
aggaaacggcagaagctcatgcctaatttctcagatagtttcggcggcgggagcggagct
ggagctggaggcggaggcatgtttggcagtggcggtggaggagggggtgctggaggtacg
gggccagggtatggcttccctcactacggatttcctacatatggtggaattactttccat
cctggaaccactaaatctaatgccgggatgaaacatggaaccataaacaccctatctaaa
aatgattctgaaggttgtggcaagagtgtggacagagaggcagtgaacctctctgggaaa
gtaactgaacccacagaacgagataaggagtccagctctggggatgatgagattactctg
acgtacacagtgggagtaaaggaagagaattctaggtttcacgataacctctttctccag
aaggctatgcagcttgccaagcggcatgccaacgccctttttgactacgcggtgacaggg
gatgtgaagatgctgctggctgtccaacgccacctcactgcagtgcaggatgagaatggg
gacagtgtcttacacttagcaatcatccatcttcatgcccagcttgtgagggatctactg
gaagtcacgtctggtttgatttctgatgacatcatcaatatgagaaatgatctctaccag
acgcccttgcacctggcggtgatcaccaagcaggaagctgtggtggacgacttgctgagg
gccggggccgacctgagccttctggaccgcgcgggtaactctgtgctgcacctagccgcc
aaagaaggacaagataagatcctcagtattttactcaagcacaaaaaggcagcgccactg
atggaccaccccaatggggaaggtctaaacgccattcacctagctgtgatgagcgacagc
atgccgtgtctgctgctgctggtggccgcgggcgccgacgtcaacgcccaggagcggaag
tccgggcgcacggcgctgcacctggcagtggagcgtgacaacatctccctggctggctgc
ctgctcctggagggtgatgcccatgtagacagtacgacctatgatggaactacagccctg
cacatagcagccgggagagggtccaccaggctggcggctcttctcaaggcagcaggcgca
gatcccctggtggagaactttgagcctctctatgagctggatgactcttgggacaaagat
ggagaggatgaaggagtcgtgcctggaaccacacctctagatatggccaccaactggcag
gtatttgatatattaaatgggaagccatacgagccagagtttacatctgatgatttattg
gcgcaaggagacatgaaacagctgactgaggaggcaaagctgcagctctacaagttgcta
gaaatccctgatccagacaaaaactgggctactctggcacagaaattaggtctggggata
ctaaataatgccttccggctgagtcctgctccttctaaaactcttatggacaactacgag
gtctccgggggcacgataagagagctggtggaggccctaagacaaatgggctataccgaa
gccatcgaagtgatccaggcggccttctgcaccccgggatctgtggcccccggccccggg
aaggccatacctcagaccctctcgctgcccctctcacctgcctccacgaggtcaccacta
gacgaggtccgagacgacagcatctgcgacagcggcgtggagacgtccttccgcaaactc
agctttacagagtctctgaccagtggcagctccttgctgactcttaacaaagtgccccac
gagtacgggcaggaaggacccatagagggcaaaatctag

DBGET integrated database retrieval system