KEGG   Ursus arctos horribilis: 113244178
Entry
113244178         CDS       T05909                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04140  Autophagy - animal
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04370  VEGF signaling pathway
uah04510  Focal adhesion
uah04722  Neurotrophin signaling pathway
uah04910  Insulin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah05010  Alzheimer disease
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05165  Human papillomavirus infection
uah05168  Herpes simplex virus 1 infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05215  Prostate cancer
uah05218  Melanoma
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05223  Non-small cell lung cancer
uah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113244178 (BAD)
   04012 ErbB signaling pathway
    113244178 (BAD)
   04370 VEGF signaling pathway
    113244178 (BAD)
   04024 cAMP signaling pathway
    113244178 (BAD)
   04022 cGMP-PKG signaling pathway
    113244178 (BAD)
   04151 PI3K-Akt signaling pathway
    113244178 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113244178 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    113244178 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113244178 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113244178 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113244178 (BAD)
   04919 Thyroid hormone signaling pathway
    113244178 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113244178 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113244178 (BAD)
   05203 Viral carcinogenesis
    113244178 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113244178 (BAD)
   05212 Pancreatic cancer
    113244178 (BAD)
   05225 Hepatocellular carcinoma
    113244178 (BAD)
   05221 Acute myeloid leukemia
    113244178 (BAD)
   05220 Chronic myeloid leukemia
    113244178 (BAD)
   05218 Melanoma
    113244178 (BAD)
   05211 Renal cell carcinoma
    113244178 (BAD)
   05215 Prostate cancer
    113244178 (BAD)
   05213 Endometrial cancer
    113244178 (BAD)
   05223 Non-small cell lung cancer
    113244178 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113244178 (BAD)
   05014 Amyotrophic lateral sclerosis (ALS)
    113244178 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113244178 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113244178 (BAD)
   05162 Measles
    113244178 (BAD)
   05161 Hepatitis B
    113244178 (BAD)
   05160 Hepatitis C
    113244178 (BAD)
   05168 Herpes simplex virus 1 infection
    113244178 (BAD)
   05165 Human papillomavirus infection
    113244178 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113244178 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113244178 (BAD)
   01524 Platinum drug resistance
    113244178 (BAD)
   01522 Endocrine resistance
    113244178 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 113244178
NCBI-ProteinID: XP_026339148
UniProt: A0A3Q7V890
LinkDB
Position
Unknown
AA seq 168 aa
MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGPGKHRQTAPGLLGEAAHPQGQPASSNH
HGGAGAVEPRSRHSSYPAGTEEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSD
EFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcccagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggaccagcccccaggccctggcaagcaccggcagaca
gccccaggcctcctaggggaagctgctcacccccaggggcagccggccagcagcaaccac
catggaggcgctggggctgtggagccccggagtcgccacagctcgtaccccgcggggacc
gaagaggatgaagggttggaggaggaagagctcagccctttccgggggcgctcgagctca
gcgccccccaacctctgtgctgcactgcgctatggccgcgagctccggaggatgagcgac
gagttccagggctccttcaagggacttcctcgcccgaagagcgcgggcacagcgacgcag
atgcgacaaagccccagctggacgcgcgtcatccagtcctggtgggatcggaacttgggg
agaggaggctccgccccctcccaatga

DBGET integrated database retrieval system