KEGG   Ursus arctos horribilis: 113244442
Entry
113244442         CDS       T05909                                 

Gene name
TSHB
Definition
(RefSeq) thyrotropin subunit beta
  KO
K05251  thyrotropin subunit beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04024  cAMP signaling pathway
uah04080  Neuroactive ligand-receptor interaction
uah04918  Thyroid hormone synthesis
uah04923  Regulation of lipolysis in adipocytes
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    113244442 (TSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113244442 (TSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    113244442 (TSHB)
   04918 Thyroid hormone synthesis
    113244442 (TSHB)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113244442 (TSHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 113244442
NCBI-ProteinID: XP_026339563
UniProt: A0A3Q7UTL1
LinkDB
Position
Unknown
AA seq 138 aa
MTATYLMSMLFGLACGQVMSFCFPTEYTMHVERKECAYCLTINTTICAGYCMTRDINGKL
FLPKYALSQDVCTYKDFMYKTVEIPGCPRHVTPYFSYPVAVSCNCGKCNTDYSDCIHEAI
KTNYCTKPQKSYVVGFSI
NT seq 417 nt   +upstreamnt  +downstreamnt
atgactgctacctacctgatgtccatgctttttggccttgcatgtgggcaagtgatgtct
ttttgtttcccaactgagtatacgatgcatgtcgaaaggaaagagtgtgcttattgccta
accatcaacaccaccatctgtgctggatattgtatgacacgggatatcaatggcaaactg
tttcttcccaaatatgctctgtcccaggatgtttgtacatataaagacttcatgtacaag
actgtagaaataccaggatgcccacgccatgttactccctatttctcctaccctgtagct
gtaagctgtaactgtggcaagtgtaatactgactatagtgactgtatacatgaggccatc
aagacaaactattgtaccaaacctcagaagtcctatgtggtgggattttctatctaa

KEGG   Ursus arctos horribilis: 113264851
Entry
113264851         CDS       T05909                                 

Gene name
CGA
Definition
(RefSeq) glycoprotein hormones alpha chain
  KO
K08522  glycoprotein hormones alpha chain
Organism
uah  Ursus arctos horribilis
Pathway
uah04024  cAMP signaling pathway
uah04080  Neuroactive ligand-receptor interaction
uah04912  GnRH signaling pathway
uah04913  Ovarian steroidogenesis
uah04917  Prolactin signaling pathway
uah04918  Thyroid hormone synthesis
uah04923  Regulation of lipolysis in adipocytes
uah04929  GnRH secretion
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    113264851 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113264851 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    113264851 (CGA)
   04929 GnRH secretion
    113264851 (CGA)
   04912 GnRH signaling pathway
    113264851 (CGA)
   04913 Ovarian steroidogenesis
    113264851 (CGA)
   04917 Prolactin signaling pathway
    113264851 (CGA)
   04918 Thyroid hormone synthesis
    113264851 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113264851 (CGA)
SSDB
Motif
Pfam: Hormone_6 YrhC
Other DBs
NCBI-GeneID: 113264851
NCBI-ProteinID: XP_026367632
UniProt: A0A3Q7XWJ3
LinkDB
Position
Unknown
AA seq 120 aa
MHDYRKYAAVILTTLSVFLHILHSFPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS
NT seq 363 nt   +upstreamnt  +downstreamnt
atgcatgactacagaaaatatgcagctgtcattctgaccacactgtctgtgtttctgcat
attctccactcctttcctgatggagagtttacaatgcagggttgcccagaatgcaagcta
aaggaaaacaaatacttctccaagttgggtgccccaatttatcaatgcatgggctgctgc
ttctccagagcgtaccccaccccagcaaggtccaagaagacaatgttggtcccaaagaac
atcacctcagaagccacatgctgtgtggccaaagcatttaccaaggccacagtgatggga
aacgccaaagtggagaaccacacggagtgccactgcagtacttgctattatcacaaatct
taa

DBGET integrated database retrieval system