KEGG   Ursus arctos horribilis: 113244532
Entry
113244532         CDS       T05909                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory-associated protein of mTOR
  KO
K07204  regulatory associated protein of mTOR
Organism
uah  Ursus arctos horribilis
Pathway
uah04136  Autophagy - other
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04714  Thermogenesis
uah04910  Insulin signaling pathway
uah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113244532 (RPTOR)
   04152 AMPK signaling pathway
    113244532 (RPTOR)
   04150 mTOR signaling pathway
    113244532 (RPTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113244532 (RPTOR)
   04136 Autophagy - other
    113244532 (RPTOR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113244532 (RPTOR)
  09149 Aging
   04211 Longevity regulating pathway
    113244532 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    113244532 (RPTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    113244532 (RPTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    113244532 (RPTOR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113244532 (RPTOR)
Membrane trafficking [BR:uah04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    113244532 (RPTOR)
SSDB
Motif
Pfam: Raptor_N HEAT HEAT_2 WD40 Cnd1 HEAT_EZ Hyccin WD40_2
Other DBs
NCBI-GeneID: 113244532
NCBI-ProteinID: XP_026339723
UniProt: A0A3Q7UU28
LinkDB
Position
Unknown
AA seq 1335 aa
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEASELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLCSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILTTSSLTQSAPASPTNKGIHIHQAGGSPPTSSASSSSLTNDVTKQPVGRD
LPAGRPGAPGPTGVQYTPHSQQFPRTRKMFDKGPDQTTDDADDTAGHRSFVSATTQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRQQARQLIQKGIAKLDDQIFLN
RNPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALD
IHPQANLIACGSMNQFTAIYSGSGELINHIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYFISVYSVEKRAR
NT seq 4008 nt   +upstreamnt  +downstreamnt
atggagtccgagatgctacagtcccctcttttgggactcggggaggaagatgaggccgac
cttacagactggaacctgcctttggcttttatgaaaaagaggcactgtgagaaaatcgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagacggtcagtgtt
gccttagttttgtgcctgaatgttggcgtggaccctccagatgtggtgaagaccaccccc
tgtgcacgtctggagtgctggatcgatcctctgtcgatggggcctcagaaagctctggaa
accatcggtgcaaatttgcagaagcaatacgagaactggcagccgagggcccggtacaag
cagagcctcgacccaaccgtggacgaagtgaagaagctgtgcacgtccttgcgccgcaat
gccaaggaggagcgggtcctcttccactacaacggccacggggtgcccaggcccaccgtg
aatggggagatctgggtcttcaacaagaactacactcagtacatccctctgtctatatat
gacctgcagacgtggatgggcagcccatcgatattcgtctacgactgctccaacgccggc
ttgatcgtcaagtccttcaaacagttcgctttgcagagggagcaggagctggaggtcgcg
gccattaacccgaaccacccgctggcgcagatgcccctgcccccgtccatgaagaactgc
atccagctggctgcctgcgaggccagcgagctgctgcccatgatccccgacctcccggct
gacctcttcacgtcctgcctcaccacccccatcaaaatcgccctgcgctggttttgcatg
cagaaatgcgttagtctggtgcctggggtcacactggatttaatagaaaagattcccggc
cggctaaatgaccggaggacccctctgggagaactgaactggatcttcacggcaatcaca
gacaccatcgcgtggaatgtgctccctcgggatctcttccaaaagctcttcagacaggac
ctgttggtggctagtctgtttcggaattttctcctggcagaaaggatcatgcggtcctac
aactgcacccccgtcagcagcccacgcctgccccccacttacatgcacgccatgtggcaa
gcctgggaccttgcagtcgacatttgcctctctcagctgcccaccatcatcgaggaaggc
accgcatttcggcacagtccgttctttgctgagcagctgaccgcattccaggtgtggctc
acgatgggcgtggagaacaggaacccacccgagcaacttcccattgttctgcaggtgctg
ctgagccaggtgcaccggctgagagccctggatttgctgggacgattcctggacctgggc
ccctgggcggtgagcctggccttgtctgtgggcattttcccctacgtgctgaaactgctc
cagagctcagccagagagctgcggcccctgctggtgttcatctgggccaagatcctggcc
gtggacagttcgtgccaagctgacctggtgaaggacaacggtcacaaatacttcctgtcg
gtcttggcagacccttacatgccagctgagcaccggaccatgacggctttcatcctcgcc
gtgattgtcaacagctacaacaccggacaggaagcctgcctccagggaaacttgatcgcc
atctgcctggagcagctcaacgatccccaccccctgctgcgccagtgggtggccatctgc
ctgggacgcatctggcagaactttgactcggccaggtggtgtggcgtgagggacagcgcg
cacgagaaactgtgcagcctcctctctgaccccatccctgaggtgcgctgtgcagcggtc
ttcgcccttggcacgtttgtgggcaactctgcagagaggaccgaccactcgaccaccatc
gaccacaacgtggccatgatgctggcccagctgatcaatgacgggagccccgtggtccgc
aaggagctggtggtggctctgagtcatcttgtcgttcaatatgaaagcaatttctgcacg
gtggccttgcagttcatggaggaggagaagaactaccccttgccttctccggcaaccaca
gagggtgggagtttgacccccgtgcgggacagcccgtgcacccccagactccgctccgtg
agctcctacggaaacattcgtgccgtcaccaccgccagaagcctgaacaaatctttgcag
aatctgagcttgacagaagaatcgggcagctcggtggcgttctctcccggaaacctcagc
acgagcagcagcgccagcagcaccttgggcagccccgagaacgaggagtacatcctgtcc
ttcgagaccatcgataagatgcgccgcgtcagctcctactctgccctcaactccctcatc
ggagtttcctttaacagtgtttacactcagatttggagagttttactgcatctggctgca
gacccctatccagatgtttccgacttggccatgaaggtgctcaacagcattgcctacaag
gccacagtgaacgcccggccccagcgcatcctcaccacgtcctcgctcacccagtcagct
cccgccagccccaccaacaagggcatccacatccaccaggcagggggctcccccccgaca
tccagcgccagcagctccagcctgaccaacgacgtcacgaagcagccagtcggccgagac
ctgcccgcgggccgccctggcgccccaggccccacaggggtgcagtacacaccccactcc
cagcagttcccccgtacgcggaagatgttcgacaagggcccagaccagaccaccgacgac
gcggatgacactgcaggacacagaagcttcgtctcggccacgacgcagaccggcttctgt
gactggagtgcccggtacttcgcccagcctgtcatgaagatcccagaagaacatgacctg
gagagtcagatccgcaaggagcgggagtggcgatttcttcgcaacacgcgcgtcagacag
caggcgcgacagctcatccagaagggtatcgccaaactggacgaccagatatttctcaac
aggaatcccggtgtcccctccgtggtcaagttccacccctttacaccatgtgtggccgtg
gctgacaaagacagcatctgtttttgggactgggagaaaggggagaagctggattacttc
cacaacggaaaccctcggtacaccagggtcaccgccatggagtacctgaacggccaggac
tgctcgctgctgctcacggccacggatgatggtgccatcagagtctggaagaacttcgca
gatttggaaaagaacccagagatggtgactgcttggcaggggctctcggacatgctgccc
acaaccagaggagccgggatggtggtggactgggagcaggagactggcctcctcatgagc
tccggggacgtgcggatcgtccggatctgggacacagaccgtgagatgaaggtgcaggac
atccccacaggcgctgacagctgcgtgaccagcctgtcctgcgactcccaccgctccctc
attgtggctggcctcggcgacggctccatccgtgtctacgaccggaggatggcgctcagt
gaatgccgcgtcatgacgtaccgggagcacacggcctgggtggtgaaggcctacctccag
aagcaccccgagggccacatcatgagcgtgagtgtcaacggggacgtgcgcttcttcgac
cctcggatgccggagtctgtgaacgtccttcagatcgtgaaggggctcacggccctcgac
atccacccccaggcaaacctgatcgcctgtggctccatgaaccagttcacggccatctac
agcgggagcggggagctcataaaccacatcaagtactacgacgggtttatgggccagcgc
gtcggggccatcagctgcctggccttccacccgcactggcctcacctggccgtggggagc
aacgactacttcatctccgtgtactcggtggagaagcgcgccagatag

DBGET integrated database retrieval system