KEGG   Ursus arctos horribilis: 113244743
Entry
113244743         CDS       T05909                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04020  Calcium signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04114  Oocyte meiosis
uah04218  Cellular senescence
uah04310  Wnt signaling pathway
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04625  C-type lectin receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04720  Long-term potentiation
uah04724  Glutamatergic synapse
uah04921  Oxytocin signaling pathway
uah04922  Glucagon signaling pathway
uah04924  Renin secretion
uah05010  Alzheimer disease
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05031  Amphetamine addiction
uah05152  Tuberculosis
uah05163  Human cytomegalovirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113244743 (PPP3R1)
   04310 Wnt signaling pathway
    113244743 (PPP3R1)
   04370 VEGF signaling pathway
    113244743 (PPP3R1)
   04020 Calcium signaling pathway
    113244743 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    113244743 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113244743 (PPP3R1)
   04218 Cellular senescence
    113244743 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113244743 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    113244743 (PPP3R1)
   04660 T cell receptor signaling pathway
    113244743 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    113244743 (PPP3R1)
   04659 Th17 cell differentiation
    113244743 (PPP3R1)
   04662 B cell receptor signaling pathway
    113244743 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    113244743 (PPP3R1)
   04921 Oxytocin signaling pathway
    113244743 (PPP3R1)
   04924 Renin secretion
    113244743 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    113244743 (PPP3R1)
   04720 Long-term potentiation
    113244743 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    113244743 (PPP3R1)
   04380 Osteoclast differentiation
    113244743 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113244743 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113244743 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    113244743 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    113244743 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113244743 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113244743 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    113244743 (PPP3R1)
   05163 Human cytomegalovirus infection
    113244743 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113244743 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113244743 (PPP3R1)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     113244743 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 113244743
NCBI-ProteinID: XP_026340098
UniProt: A0A3Q7UV61
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt
aaaaggctaggaaagagatttaagaagctcgacttggacaattcgggatctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atatttgacacagatgggaatggagaagtagactttaaagaattcattgagggagtctct
cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Ursus arctos horribilis: 113259177
Entry
113259177         CDS       T05909                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04020  Calcium signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04114  Oocyte meiosis
uah04218  Cellular senescence
uah04310  Wnt signaling pathway
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04625  C-type lectin receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04720  Long-term potentiation
uah04724  Glutamatergic synapse
uah04728  Dopaminergic synapse
uah04921  Oxytocin signaling pathway
uah04922  Glucagon signaling pathway
uah04924  Renin secretion
uah05010  Alzheimer disease
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05031  Amphetamine addiction
uah05152  Tuberculosis
uah05163  Human cytomegalovirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113259177 (PPP3CB)
   04310 Wnt signaling pathway
    113259177 (PPP3CB)
   04370 VEGF signaling pathway
    113259177 (PPP3CB)
   04020 Calcium signaling pathway
    113259177 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    113259177 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113259177 (PPP3CB)
   04218 Cellular senescence
    113259177 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113259177 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    113259177 (PPP3CB)
   04660 T cell receptor signaling pathway
    113259177 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    113259177 (PPP3CB)
   04659 Th17 cell differentiation
    113259177 (PPP3CB)
   04662 B cell receptor signaling pathway
    113259177 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    113259177 (PPP3CB)
   04921 Oxytocin signaling pathway
    113259177 (PPP3CB)
   04924 Renin secretion
    113259177 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    113259177 (PPP3CB)
   04728 Dopaminergic synapse
    113259177 (PPP3CB)
   04720 Long-term potentiation
    113259177 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    113259177 (PPP3CB)
   04380 Osteoclast differentiation
    113259177 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113259177 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113259177 (PPP3CB)
   05014 Amyotrophic lateral sclerosis (ALS)
    113259177 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    113259177 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113259177 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113259177 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    113259177 (PPP3CB)
   05163 Human cytomegalovirus infection
    113259177 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113259177 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113259177 (PPP3CB)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     113259177 (PPP3CB)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     113259177 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 113259177
NCBI-ProteinID: XP_026360256
UniProt: A0A3Q7VGQ9
LinkDB
Position
Unknown
AA seq 480 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNC
SPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEI
IRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAE
KAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggatgggatacccagggttgatgttctgaagaaccacttagtaaaagaaggtcgggta
gatgaagaaattgcacttagaattatcaatgagggtgctgccatccttcggagagagaaa
accatgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcctg
aagattctgtacccaagcacattatttcttctgagaggcaatcatgaatgcagacacctt
actgaatattttacctttaagcaggaatgtaaaattaaatattcagaaagagtctatgaa
gcttgtatggaagcttttgatagtctgcctcttgctgcacttttaaatcaacaatttctt
tgtgttcatggtggactttcaccagaaatacacacactggatgatattaggagattagat
agattcaaagagccacctgcatttggaccaatgtgtgacttgctatggtccgatccttct
gaagattttggaaatgaaaaatcacaggaacattttagtcacaatacagttcgaggatgt
tcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaact
acagggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaat
aataaagctgctgtattaaagtatgaaaataatgtgatgaatattcgacagtttaactgt
tctccacatccttactggttgcccaattttatggatgtcttcacatggtctttaccattt
gttggagaaaaagtgacagaaatgttggtaaatgttctgagtatttgctctgatgatgaa
ctgatgactgaaggtgaagaccagtttgatgtaggttcagctgcagcccggaaagaaatc
ataagaaacaaaattcgagcaattggcaagatggcacgggtcttctctgttctcagggag
gagagtgaaagcgtgctgacactcaagggcctgactcccacagggatgttgcctagtgga
gtgttggctggaggacggcagaccctgcaaagtgccacagttgaggctattgaggctgaa
aaagcaatacgaggattctctccaccacatagaatctgcagttttgaagaggcaaagggt
ttggataggatcaatgagagaatgccaccccggaaagatgctgtacagcaagatggtttc
aattctctgaacaccgcacatgccactgagaaccacgggactggcaaccatagtgcccag
tga

KEGG   Ursus arctos horribilis: 113260378
Entry
113260378         CDS       T05909                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04020  Calcium signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04114  Oocyte meiosis
uah04218  Cellular senescence
uah04310  Wnt signaling pathway
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04625  C-type lectin receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04720  Long-term potentiation
uah04724  Glutamatergic synapse
uah04921  Oxytocin signaling pathway
uah04922  Glucagon signaling pathway
uah04924  Renin secretion
uah05010  Alzheimer disease
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05031  Amphetamine addiction
uah05152  Tuberculosis
uah05163  Human cytomegalovirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113260378 (PPP3R2)
   04310 Wnt signaling pathway
    113260378 (PPP3R2)
   04370 VEGF signaling pathway
    113260378 (PPP3R2)
   04020 Calcium signaling pathway
    113260378 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    113260378 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113260378 (PPP3R2)
   04218 Cellular senescence
    113260378 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113260378 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    113260378 (PPP3R2)
   04660 T cell receptor signaling pathway
    113260378 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    113260378 (PPP3R2)
   04659 Th17 cell differentiation
    113260378 (PPP3R2)
   04662 B cell receptor signaling pathway
    113260378 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    113260378 (PPP3R2)
   04921 Oxytocin signaling pathway
    113260378 (PPP3R2)
   04924 Renin secretion
    113260378 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    113260378 (PPP3R2)
   04720 Long-term potentiation
    113260378 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    113260378 (PPP3R2)
   04380 Osteoclast differentiation
    113260378 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113260378 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113260378 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    113260378 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    113260378 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260378 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113260378 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    113260378 (PPP3R2)
   05163 Human cytomegalovirus infection
    113260378 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260378 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113260378 (PPP3R2)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     113260378 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 113260378
NCBI-ProteinID: XP_026361895
UniProt: A0A3Q7WAL0
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPEEMCSHFNPDEIKRLGKRFKKLDLDSSGALSLEEFMSLPELQQNPLVQRVVD
VFDTDGNGEVDFKEFILGTSQFSVRGDEEQKLRFAFSIYDIDKDGYISNGELFQVLKLMV
GNNLKDWQLQQLVDKTIIILDQDGDGKISFEEFCTVVGGLEIHKKLVVIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaagccagttacccggaggaaatgtgctcccacttcaaccctgacgaaatc
aaaaggctgggcaagaggtttaagaagctggacttggactcttcgggcgcactgagcctg
gaggagttcatgtccctgcccgagctgcagcagaatccgttggtgcagcgagtggtcgac
gtcttcgacaccgacggcaacggagaagtggacttcaaggagttcatcctggggacctcc
cagttcagcgtcaggggggacgaggagcaaaagttgaggtttgccttcagcatctacgac
atcgataaagacggctacatttccaacggggagctcttccaggtgctgaagctgatggtg
ggcaacaacctgaaggactggcagctgcagcagctcgtggacaaaaccatcatcatcctg
gaccaggatggagacggcaaaatatccttcgaggaattctgcactgtggtcggaggcctg
gagatccacaagaagttggtggtgatagtgtga

KEGG   Ursus arctos horribilis: 113263105
Entry
113263105         CDS       T05909                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04020  Calcium signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04114  Oocyte meiosis
uah04218  Cellular senescence
uah04310  Wnt signaling pathway
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04625  C-type lectin receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04720  Long-term potentiation
uah04724  Glutamatergic synapse
uah04728  Dopaminergic synapse
uah04921  Oxytocin signaling pathway
uah04922  Glucagon signaling pathway
uah04924  Renin secretion
uah05010  Alzheimer disease
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05031  Amphetamine addiction
uah05152  Tuberculosis
uah05163  Human cytomegalovirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113263105 (PPP3CA)
   04310 Wnt signaling pathway
    113263105 (PPP3CA)
   04370 VEGF signaling pathway
    113263105 (PPP3CA)
   04020 Calcium signaling pathway
    113263105 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    113263105 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113263105 (PPP3CA)
   04218 Cellular senescence
    113263105 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113263105 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    113263105 (PPP3CA)
   04660 T cell receptor signaling pathway
    113263105 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    113263105 (PPP3CA)
   04659 Th17 cell differentiation
    113263105 (PPP3CA)
   04662 B cell receptor signaling pathway
    113263105 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    113263105 (PPP3CA)
   04921 Oxytocin signaling pathway
    113263105 (PPP3CA)
   04924 Renin secretion
    113263105 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    113263105 (PPP3CA)
   04728 Dopaminergic synapse
    113263105 (PPP3CA)
   04720 Long-term potentiation
    113263105 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    113263105 (PPP3CA)
   04380 Osteoclast differentiation
    113263105 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113263105 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113263105 (PPP3CA)
   05014 Amyotrophic lateral sclerosis (ALS)
    113263105 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    113263105 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113263105 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113263105 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    113263105 (PPP3CA)
   05163 Human cytomegalovirus infection
    113263105 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113263105 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113263105 (PPP3CA)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     113263105 (PPP3CA)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     113263105 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 113263105
NCBI-ProteinID: XP_026365437
UniProt: A0A3Q7XR54
LinkDB
Position
Unknown
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcatcggcttacagcaaaagaagtgtttgataacgatggaaaa
cctcgtgtggatatcttaaaggcacatctcatgaaggagggcaggctggaagagagcgtt
gcattgagaataataacagagggggcttccattcttcgacaggaaaagaatttgctggat
attgatgcaccagtcacagtttgtggggacatccatggacaattctttgacttgatgaag
ctttttgaagtggggggatctcctgccaacactcgctacctcttcttgggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgcggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgacgcctgtatggat
gcctttgactgcctgcccctggctgctctgatgaaccaacagttcctgtgtgtccacggg
ggtttatctccagagattaacactttagatgacatcaggaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgtgatatcctgtggtcagacccgctggaggattttgga
aacgagaagactcaggaacatttcactcacaacacagtcagggggtgttcgtacttctac
agttacccggctgtgtgtgaattcttacagcacaataatttgttatctatactccgagcc
catgaagcccaggatgcagggtatcgcatgtacaggaaaagccaaacgacaggcttccct
tctctaatcacaattttctcagcaccaaattacttagatgtatacaataacaaagctgca
gtgttgaagtatgagaacaacgtcatgaatatcaggcagttcaactgttctcctcacccc
tactggcttccaaatttcatggatgttttcacttggtccctgccatttgttggggaaaaa
gttaccgagatgcttgtaaatgtcctcaacatctgctcagatgatgaactggggtcagaa
gaagatggatttgatggagcaacagccgcagcccggaaggaggtgataaggaacaagatc
cgagcaataggcaaaatggcccgagtgttctcggttctcagagaagagagcgagagtgtg
ctgacgctgaaaggcttgacccccacgggcatgctccccagcggagtgctttctggaggg
aagcagacactgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaagaggccaagggcttagaccgaattaac
gagaggatgccacctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacagacagcaatggcagtaatagcagcaatatc
cagtga

KEGG   Ursus arctos horribilis: 113270001
Entry
113270001         CDS       T05909                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04020  Calcium signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04114  Oocyte meiosis
uah04218  Cellular senescence
uah04310  Wnt signaling pathway
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04625  C-type lectin receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04720  Long-term potentiation
uah04724  Glutamatergic synapse
uah04728  Dopaminergic synapse
uah04921  Oxytocin signaling pathway
uah04922  Glucagon signaling pathway
uah04924  Renin secretion
uah05010  Alzheimer disease
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05031  Amphetamine addiction
uah05152  Tuberculosis
uah05163  Human cytomegalovirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113270001 (PPP3CC)
   04310 Wnt signaling pathway
    113270001 (PPP3CC)
   04370 VEGF signaling pathway
    113270001 (PPP3CC)
   04020 Calcium signaling pathway
    113270001 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    113270001 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113270001 (PPP3CC)
   04218 Cellular senescence
    113270001 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113270001 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    113270001 (PPP3CC)
   04660 T cell receptor signaling pathway
    113270001 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    113270001 (PPP3CC)
   04659 Th17 cell differentiation
    113270001 (PPP3CC)
   04662 B cell receptor signaling pathway
    113270001 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    113270001 (PPP3CC)
   04921 Oxytocin signaling pathway
    113270001 (PPP3CC)
   04924 Renin secretion
    113270001 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    113270001 (PPP3CC)
   04728 Dopaminergic synapse
    113270001 (PPP3CC)
   04720 Long-term potentiation
    113270001 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    113270001 (PPP3CC)
   04380 Osteoclast differentiation
    113270001 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113270001 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113270001 (PPP3CC)
   05014 Amyotrophic lateral sclerosis (ALS)
    113270001 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    113270001 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113270001 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113270001 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    113270001 (PPP3CC)
   05163 Human cytomegalovirus infection
    113270001 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113270001 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113270001 (PPP3CC)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     113270001 (PPP3CC)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     113270001 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 113270001
NCBI-ProteinID: XP_026374815
UniProt: A0A3Q7XBE7
LinkDB
Position
Unknown
AA seq 525 aa
MSGRNLHLSTTERVIKAVPFPPTQRLTLKEVFENGKPKIDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLFLWSLKINHPKTVFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIKKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDEIEGGTTVRKEIIKNKIRAIGKMARVFSILREESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLDRINERMPPR
KDSQYPDGPVKLVAPPQPNAAHRNDRGRRASNDAEPCCGTGGSKT
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtccgggaggaacctccacctctccaccaccgaacgcgtcatcaaagctgttcccttt
cctccaacccaacggcttactttgaaggaagtgtttgagaatgggaaacctaaaattgat
gttttgaaaaaccatttggtgaaagaagggcgactggaagaggaagtagccttaaagata
atcaatgatggggctgccatcctgagacaagagaagaccatgatagaagtagatgctcca
atcacagtgtgtggtgacattcatggacagttttttgacctgatgaagttgtttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtttttatggagtttaaagattaatcatcccaaaacagtg
tttctgcttcgaggaaatcatgaatgcaggcatcttacagaatacttcaccttcaaacag
gaatgtcgaatcaaatattctgaacaggtgtatgatgcgtgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctgtgtgtacatggagggatgtcacct
gaaattactagtttagatgacattaagaaattagaccggtttaaagaacctccagccttt
gggccagtgtgtgacctgctttggtctgatccttcagaggattatggcaatgaaaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttttacagttaccctgca
gtctgtgaatttttgcagaacaataatttgttatcaataatcagagctcatgaagcccag
gatgctgggtatcgaatgtacaggaagagccaaacaacaggctttccgtcactcattaca
attttctctgcccccaattacctagatgtctataataataaagctgctgtgctaaaatac
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttccg
aactttatggacgttttcacatggtctttgccatttgttggggaaaaagtcacagagatg
ctggttaacattctcaacatatgctctgatgatgaattgatttccgatgatgaaattgaa
ggaggcactacagttcgaaaggaaatcatcaagaataagatcagagccattgggaagatg
gcacgagtcttttcaattctgcgggaagagagtgagagtgtgctgactctcaagggcctg
actccaacagggacactccctctaggtgtcctctcaggaggaaaacagaccattgagaca
gccacagtagaagcggtagaggcccgggaagccatcagagggttttcgcttcagcacagg
atccggagttttgaagaagcccgaggtctggaccgaattaacgaacggatgccaccccga
aaagacagccagtaccccgatgggccagtgaaattggttgcccctccacaacccaacgct
gcgcacaggaacgacagggggagaagagccagtaatgacgcagagccctgctgtggcaca
ggtggatccaaaacttaa

DBGET integrated database retrieval system