KEGG   Ursus arctos horribilis: 113245027
Entry
113245027         CDS       T05909                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M isoform X1
  KO
K05418  oncostatin M
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113245027 (OSM)
   04151 PI3K-Akt signaling pathway
    113245027 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113245027 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113245027 (OSM)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113245027 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 113245027
NCBI-ProteinID: XP_026340583
UniProt: A0A3Q7VC93
LinkDB
Position
Unknown
AA seq 238 aa
MQAQLLRRTLPSLVLGLLFLSTPAMGVCLDKYQELFGQLQKQTDIMQRTSLLLDPYIKSQ
GLDKDGLKEHCRERPGAFPSKDALQRLSRREFLRALHTTLGSVLHRLTALQRDVPKAQDL
EMLNRAKQNIRGFRNNIHCMAQLLPDSSETTEPTPAGPATSPSPTPTSDTFQRRLEGCRF
LHGYHRFMHSVGQVFQEWGESPSRSRRHSPRRGLRKGVRRVQLSRRNKRLPPRGQLPR
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcaggcacagcttttgcggaggaccctgcccagtctggtccttggactcctgttcctg
agcacgccggccatgggcgtctgtttggacaagtaccaagagctgtttgggcagctccag
aagcagacggacatcatgcagcgcaccagcctgctcctggacccctatatcaaaagccaa
ggcctggacaaggatggactgaaggagcactgccgggagcgcccgggggccttccccagc
aaagacgccctgcagcggctgagcaggagggaattcctgcgggccctccacaccacgctg
ggcagcgttctgcacagactgactgccctgcagcgggacgtccccaaggcccaggacttg
gagatgctgaatagggcaaagcagaacattcgcgggttcaggaacaacatccactgcatg
gcccagctgcttccagactcctcggagacaacggagcccactcccgcaggcccggcgaca
tctccgtcgcccacccccacctcagacacctttcagcgcaggctagagggctgcaggttc
ctgcacggctatcaccgcttcatgcactccgtggggcaggtgttccaagagtggggggag
agcccgagtcggagccggagacacagcccccgccggggcctgcgaaagggggttcgcagg
gtgcaactgtccaggaggaacaagagactcccacccagggggcagctgccccggtag

KEGG   Ursus arctos horribilis: 113253022
Entry
113253022         CDS       T05909                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7
  KO
K05431  interleukin 7
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113253022 (IL7)
   04151 PI3K-Akt signaling pathway
    113253022 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113253022 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113253022 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113253022 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113253022 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113253022 (IL7)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113253022 (IL7)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113253022 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 113253022
NCBI-ProteinID: XP_026351633
UniProt: A0A3Q7VRL5
LinkDB
Position
Unknown
AA seq 158 aa
MFHVSFRYIFGIPPLILVLLPVASSDCDIEGKDGREYQHVLMISINDLDTMIKNRTNCPN
NEPKVLKKHACDDNKEGMFLYRAARKLKQFVKVNNSEDFNLHLSRVSQGTLQLLNCTPKE
DNKSVKEQRKQKSLCSLGILLQKIKTCWNKILRGSKEH
NT seq 477 nt   +upstreamnt  +downstreamnt
atgttccatgtttctttcaggtatatctttggaattcctcccctgatccttgttctgttg
ccggtagcatcatccgactgtgatattgaaggtaaagacggcagagagtaccaacacgtt
ctcatgatcagcatcaatgacttggacaccatgataaaaaatcgtaccaattgcccgaat
aatgaacctaaagtattaaaaaaacatgcatgtgatgataataaggaaggtatgtttcta
tatcgtgctgctcgcaagttgaagcagtttgttaaagtgaataacagtgaggatttcaat
ctccacttatcaagagtctcacagggcacattacaattgttgaactgtacccccaaggaa
gacaataaatctgtaaaggaacagagaaaacagaagagcttgtgttccctagggatacta
ctacaaaagataaaaacttgttggaataaaattttgaggggctctaaagaacattga

KEGG   Ursus arctos horribilis: 113255635
Entry
113255635         CDS       T05909                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04151  PI3K-Akt signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113255635 (IL2)
   04151 PI3K-Akt signaling pathway
    113255635 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113255635 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113255635 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113255635 (IL2)
   04660 T cell receptor signaling pathway
    113255635 (IL2)
   04658 Th1 and Th2 cell differentiation
    113255635 (IL2)
   04659 Th17 cell differentiation
    113255635 (IL2)
   04672 Intestinal immune network for IgA production
    113255635 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255635 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113255635 (IL2)
   05321 Inflammatory bowel disease (IBD)
    113255635 (IL2)
   05330 Allograft rejection
    113255635 (IL2)
   05332 Graft-versus-host disease
    113255635 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113255635 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113255635 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113255635 (IL2)
   05162 Measles
    113255635 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113255635 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255635 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113255635 (IL2)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113255635 (IL2)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113255635 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 113255635
NCBI-ProteinID: XP_026355067
UniProt: A0A3Q7WXD6
LinkDB
Position
Unknown
AA seq 155 aa
MYKMQLLYCIALTLVLVANSAPTTSSPTKETQQQLEQLLLDLRLLLNGVNNYENPKLSRM
LTFKFYMPKKATELKHLQCLAEELKLLEEVLYLDQSKNLHLTDIKELMSNINVTLLKLKG
SEASFKCEYDDETVTITEFLNKWITFCQSIFSTLT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtattgcatcgcactgactcttgtactcgtcgcaaacagt
gcacctactacttcaagccctacgaaggaaacacagcaacagctggagcaattgctgctg
gatttacggttgctcttgaatggagttaataattatgagaaccccaaactctccaggatg
ctcacgtttaaattctacatgcccaagaaggccacagaattgaaacatcttcaatgtcta
gcagaagaactcaaacttctggaggaagtgctatatttagatcaaagcaaaaaccttcac
ttgacagacatcaaggaattaatgagcaatatcaatgtaacacttctgaaactaaaggga
tcagaagcaagtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctg
aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

KEGG   Ursus arctos horribilis: 113260290
Entry
113260290         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260290
   04151 PI3K-Akt signaling pathway
    113260290
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260290
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260290
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260290
   04621 NOD-like receptor signaling pathway
    113260290
   04622 RIG-I-like receptor signaling pathway
    113260290
   04623 Cytosolic DNA-sensing pathway
    113260290
   04650 Natural killer cell mediated cytotoxicity
    113260290
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260290
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260290
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260290
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260290
   05162 Measles
    113260290
   05164 Influenza A
    113260290
   05161 Hepatitis B
    113260290
   05160 Hepatitis C
    113260290
   05168 Herpes simplex virus 1 infection
    113260290
   05163 Human cytomegalovirus infection
    113260290
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260290
   05169 Epstein-Barr virus infection
    113260290
   05165 Human papillomavirus infection
    113260290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260290
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260290
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260290
NCBI-ProteinID: XP_026361780
UniProt: A0A3Q7WAA5
LinkDB
Position
Unknown
AA seq 187 aa
MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTRDFA
FPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSEQLSALE
ACPMQAARVGETPAMNVDSILRNYFQRISLYLQEKQYSPCAWETVRAEITSSLFSSTILQ
EGLRRKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacgtgactttgcc
ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg
catgtgatgaaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg
aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgccctggaa
gcctgtcccatgcaggcggcgcgagtgggagagactcccgccatgaatgtggactccatc
ctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagcccttgt
gcctgggagactgtcagagcagaaatcacgagctccttgttttcttcaacgatcttgcaa
gaaggactaaggcgcaagaaatga

KEGG   Ursus arctos horribilis: 113260291
Entry
113260291         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260291
   04151 PI3K-Akt signaling pathway
    113260291
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260291
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260291
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260291
   04621 NOD-like receptor signaling pathway
    113260291
   04622 RIG-I-like receptor signaling pathway
    113260291
   04623 Cytosolic DNA-sensing pathway
    113260291
   04650 Natural killer cell mediated cytotoxicity
    113260291
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260291
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260291
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260291
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260291
   05162 Measles
    113260291
   05164 Influenza A
    113260291
   05161 Hepatitis B
    113260291
   05160 Hepatitis C
    113260291
   05168 Herpes simplex virus 1 infection
    113260291
   05163 Human cytomegalovirus infection
    113260291
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260291
   05169 Epstein-Barr virus infection
    113260291
   05165 Human papillomavirus infection
    113260291
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260291
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260291
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260291
NCBI-ProteinID: XP_026361781
UniProt: A0A3Q7VL96
LinkDB
Position
Unknown
AA seq 187 aa
MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTHDFA
FPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSEQLSVLE
ACPMQAARVGETPGMNVDSILRNYFQRISLYLQAKQYSPCAWETVRAEIMKPLFSSTILQ
EGLRRKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacatgactttgcc
ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg
catgtgatgaaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg
aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa
gcctgtcccatgcaggcggcgcgagtgggagagactcccggcatgaatgtggactccatc
ctgaggaactacttccaaagaatctccctctacctgcaagcgaagcaatacagcccttgt
gcctgggagactgtcagagcagaaatcatgaaacccttgttttcatcaacaatcttgcaa
gaaggactaaggcgcaagaaatga

KEGG   Ursus arctos horribilis: 113260293
Entry
113260293         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260293
   04151 PI3K-Akt signaling pathway
    113260293
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260293
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260293
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260293
   04621 NOD-like receptor signaling pathway
    113260293
   04622 RIG-I-like receptor signaling pathway
    113260293
   04623 Cytosolic DNA-sensing pathway
    113260293
   04650 Natural killer cell mediated cytotoxicity
    113260293
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260293
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260293
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260293
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260293
   05162 Measles
    113260293
   05164 Influenza A
    113260293
   05161 Hepatitis B
    113260293
   05160 Hepatitis C
    113260293
   05168 Herpes simplex virus 1 infection
    113260293
   05163 Human cytomegalovirus infection
    113260293
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260293
   05169 Epstein-Barr virus infection
    113260293
   05165 Human papillomavirus infection
    113260293
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260293
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260293
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260293
NCBI-ProteinID: XP_026361783
UniProt: A0A3Q7WJP5
LinkDB
Position
Unknown
AA seq 228 aa
METDVFPFKRAHKARCSENLEPRFPDLPTPARPAASAGSPMALPFSFLVALVVLSGNSLC
SLGCDLPQNHGLFAWRALTLLGQMKRISLISCVHKYTHDFAFPKEVVDGKQLQKAQALSV
VHVMNQKIFHIFCTEASSAAWNTTLLEEFCSGLSEQLSVLEACPMQAARVGETPGMNVDS
ILRNYFQRISLYLQEKQYSPCAWETVRAEIMKPFSSSTTLQERLRGKK
NT seq 687 nt   +upstreamnt  +downstreamnt
atggaaactgatgtgttcccatttaagagggctcacaaggcaagatgctcagagaaccta
gagccacggttcccagacttgcccaccccagccaggccagcagcctctgcaggatcccca
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatctcccttatctcttgtgtacacaagtacacacatgacttt
gccttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtc
gtgcatgtgatgaaccagaagatcttccacatcttctgcacagaggcctcatctgctgct
tggaacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctg
gaagcctgtcccatgcaggcggcgcgagtgggagagactcccggcatgaatgtggactcc
atcctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagccct
tgtgcctgggagactgtcagagcagaaatcatgaaacccttctcttcatcaacaaccttg
caagaaaggttaaggggcaagaaatga

KEGG   Ursus arctos horribilis: 113260294
Entry
113260294         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260294
   04151 PI3K-Akt signaling pathway
    113260294
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260294
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260294
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260294
   04621 NOD-like receptor signaling pathway
    113260294
   04622 RIG-I-like receptor signaling pathway
    113260294
   04623 Cytosolic DNA-sensing pathway
    113260294
   04650 Natural killer cell mediated cytotoxicity
    113260294
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260294
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260294
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260294
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260294
   05162 Measles
    113260294
   05164 Influenza A
    113260294
   05161 Hepatitis B
    113260294
   05160 Hepatitis C
    113260294
   05168 Herpes simplex virus 1 infection
    113260294
   05163 Human cytomegalovirus infection
    113260294
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260294
   05169 Epstein-Barr virus infection
    113260294
   05165 Human papillomavirus infection
    113260294
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260294
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260294
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260294
NCBI-ProteinID: XP_026361784
UniProt: A0A3Q7X5I4
LinkDB
Position
Unknown
AA seq 183 aa
MALSISVLLALVMLCSSPACSLDCTLRPSHPEPFVLLSQMERISILSCLKDRTDFSFPQM
LVDGSKFEKTEATAVMHEMFQQIFNLFSQSGSLVAWDETPLDKFLAGLHQQLEDLETCLE
EEKNVEQLLLGSENSRLAVKRYFHGIGLYLEKKKYSRCAWEVVRVEIRRCLFFVNELAGK
LRK
NT seq 552 nt   +upstreamnt  +downstreamnt
atggccctctcgatctctgtgctgctggccctggtgatgctgtgctccagccctgcctgc
tctttggactgcaccctgcgtccaagccatccagaacccttcgtgctgttgagtcaaatg
gagagaatctccattctatcctgtctgaaggataggactgacttcagctttcctcagatg
cttgtggatgggagcaagtttgagaagacagaagccacagctgtcatgcatgagatgttc
cagcagatcttcaacctcttcagccaaagtggctctcttgtggcttgggatgagacccca
ctagacaaattcctcgctggacttcatcagcagctggaagacctggagacatgtttggag
gaggaaaagaatgtggaacagttactcctgggaagcgagaactccagactggctgtgaag
agatacttccatggaatcggtctctatcttgaaaagaaaaaatacagccgctgtgcctgg
gaggttgtcagggtggaaatcagaaggtgcttgttcttcgttaacgagctcgcagggaaa
ctcaggaaataa

KEGG   Ursus arctos horribilis: 113260295
Entry
113260295         CDS       T05909                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04668  TNF signaling pathway
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260295 (IFNB1)
   04668 TNF signaling pathway
    113260295 (IFNB1)
   04151 PI3K-Akt signaling pathway
    113260295 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260295 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260295 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260295 (IFNB1)
   04621 NOD-like receptor signaling pathway
    113260295 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    113260295 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    113260295 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    113260295 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113260295 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113260295 (IFNB1)
   05152 Tuberculosis
    113260295 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260295 (IFNB1)
   05162 Measles
    113260295 (IFNB1)
   05164 Influenza A
    113260295 (IFNB1)
   05161 Hepatitis B
    113260295 (IFNB1)
   05160 Hepatitis C
    113260295 (IFNB1)
   05168 Herpes simplex virus 1 infection
    113260295 (IFNB1)
   05163 Human cytomegalovirus infection
    113260295 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260295 (IFNB1)
   05169 Epstein-Barr virus infection
    113260295 (IFNB1)
   05165 Human papillomavirus infection
    113260295 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113260295 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260295 (IFNB1)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260295 (IFNB1)
SSDB
Motif
Pfam: Interferon VitK2_biosynth
Other DBs
NCBI-GeneID: 113260295
NCBI-ProteinID: XP_026361786
UniProt: A0A3Q7VLA1
LinkDB
Position
Unknown
AA seq 186 aa
MTSRCILQTALLVYFSTTVLAVNYDLLRFQLSSSSVECQELLLQLNGTTKDCLKDRMNFK
FPEEIEKSQQFQKEDFILVTLEMFQKTSDIFRRNLSSTGWNEIIVKNLLETLHWQKEHLE
EILEKIMEEENFTWDDRTLLHLKKYYLRIVRYLKAKEYSICAWTIVQAEMLRSFFFLDKL
TDYLPN
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccagcaggtgcatcctccaaaccgctctcctggtgtatttctccaccacggttctc
gccgtgaactacgacttgcttcgattccaactaagcagcagcagtgtggagtgccaggag
ctccttctgcagttgaatggaacgactaaagattgcctcaaggaccggatgaacttcaag
ttccctgaggagatcgagaaatcccagcagttccagaaggaggacttcatattggtcacc
cttgagatgttccagaagacctctgatattttcaggagaaatctctcgagcacagggtgg
aatgagatcattgtcaagaacctccttgagacgctccattggcagaaggaacatctggag
gaaatcctggagaaaatcatggaggaggaaaacttcacctgggacgacaggacccttctg
cacctgaagaaatattatctaaggatcgtgcgatacctgaaggccaaggagtacagcatt
tgtgcctggacaatagtgcaagcagagatgctcaggagctttttcttccttgataaactt
acggattatctcccaaactga

KEGG   Ursus arctos horribilis: 113261280
Entry
113261280         CDS       T05909                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01523  Antifolate resistance
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04218  Cellular senescence
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04657  IL-17 signaling pathway
uah04659  Th17 cell differentiation
uah04668  TNF signaling pathway
uah04672  Intestinal immune network for IgA production
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05010  Alzheimer disease
uah05020  Prion diseases
uah05132  Salmonella infection
uah05133  Pertussis
uah05134  Legionellosis
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
uah05332  Graft-versus-host disease
uah05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261280 (IL6)
   04668 TNF signaling pathway
    113261280 (IL6)
   04066 HIF-1 signaling pathway
    113261280 (IL6)
   04068 FoxO signaling pathway
    113261280 (IL6)
   04151 PI3K-Akt signaling pathway
    113261280 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261280 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113261280 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    113261280 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261280 (IL6)
   04620 Toll-like receptor signaling pathway
    113261280 (IL6)
   04621 NOD-like receptor signaling pathway
    113261280 (IL6)
   04623 Cytosolic DNA-sensing pathway
    113261280 (IL6)
   04625 C-type lectin receptor signaling pathway
    113261280 (IL6)
   04659 Th17 cell differentiation
    113261280 (IL6)
   04657 IL-17 signaling pathway
    113261280 (IL6)
   04672 Intestinal immune network for IgA production
    113261280 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261280 (IL6)
   05202 Transcriptional misregulation in cancer
    113261280 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113261280 (IL6)
   05321 Inflammatory bowel disease (IBD)
    113261280 (IL6)
   05332 Graft-versus-host disease
    113261280 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113261280 (IL6)
   05020 Prion diseases
    113261280 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    113261280 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113261280 (IL6)
   04931 Insulin resistance
    113261280 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113261280 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113261280 (IL6)
   05135 Yersinia infection
    113261280 (IL6)
   05133 Pertussis
    113261280 (IL6)
   05134 Legionellosis
    113261280 (IL6)
   05152 Tuberculosis
    113261280 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113261280 (IL6)
   05162 Measles
    113261280 (IL6)
   05164 Influenza A
    113261280 (IL6)
   05161 Hepatitis B
    113261280 (IL6)
   05168 Herpes simplex virus 1 infection
    113261280 (IL6)
   05163 Human cytomegalovirus infection
    113261280 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113261280 (IL6)
   05169 Epstein-Barr virus infection
    113261280 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113261280 (IL6)
   05144 Malaria
    113261280 (IL6)
   05142 Chagas disease (American trypanosomiasis)
    113261280 (IL6)
   05143 African trypanosomiasis
    113261280 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113261280 (IL6)
   01523 Antifolate resistance
    113261280 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261280 (IL6)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261280 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL11 IL23
Other DBs
NCBI-GeneID: 113261280
NCBI-ProteinID: XP_026363207
UniProt: A0A3Q7XKP5
LinkDB
Position
Unknown
AA seq 240 aa
MRLGMSEAHSALEPTRNERELHLPSRTPAMNSLSTSAFSPVAFSLGLLLVMATAFPTPGH
LGRDSKDEATSNRPPLISADKMEIIKYILGRISALKKEMCDKYNKCEDSKEALAENNLHL
PKLAEKDGCFQSGFNQDTCLTRIATGLLEFQVHLKYLQANYEGDKENANSVYFSTKVLLQ
MLMEKVKNQDEVTTPDPTTDTGLQAILKSQDKWLKQTTIHLILRNLEDFLQFSLRAVRVM
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagactggggatgtctgaggctcattctgccctcgagcccaccaggaacgaaagagag
ctccatctgccctccaggaccccagctatgaactccctctccacaagcgccttcagtcca
gttgccttctccctggggctgctcctggtgatggctactgctttccctaccccgggacac
ctgggaagagattccaaagatgaggccacctcaaatagaccaccactcatctctgcagac
aaaatggaaatcattaaatacatcctcggcagaatctctgcactgaaaaaggagatgtgt
gacaagtataacaagtgtgaagacagcaaggaggcactggcagaaaacaacttacatctt
ccaaaactggcagaaaaggacggatgcttccaatctgggttcaatcaggacacctgcctg
acaagaatcgctaccggtcttctggagtttcaggtacacctgaaatacctccaggccaac
tatgaaggtgataaggaaaatgccaactctgtgtacttcagtaccaaagtcctgctccag
atgctgatggaaaaggtaaagaatcaggatgaagtgaccaccccagaccccaccacagac
accggcctgcaggctatcctgaagtcgcaggacaagtggctgaagcaaacaacaattcac
ctcatcctgcggaaccttgaggatttcctgcagttcagcctgagggcagtgcgggtcatg
tag

KEGG   Ursus arctos horribilis: 113261704
Entry
113261704         CDS       T05909                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04664  Fc epsilon RI signaling pathway
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05221  Acute myeloid leukemia
uah05310  Asthma
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261704
   04151 PI3K-Akt signaling pathway
    113261704
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261704
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113261704
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261704
   04664 Fc epsilon RI signaling pathway
    113261704
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261704
   05202 Transcriptional misregulation in cancer
    113261704
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    113261704
  09163 Immune disease
   05310 Asthma
    113261704
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261704
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113261704
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261704
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113261704
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 113261704
NCBI-ProteinID: XP_026363707
UniProt: A0A3Q7XLV0
LinkDB
Position
Unknown
AA seq 142 aa
MHSLPILHVLLLLLGLRAPMAQGRSLSTYQPKQYFKMISEIMDILNNSPSPSEETLDPNE
TSTLLNTTLLRPNLDAFLNATKNFYNSESLIWKNLKEFLPLLPTPTPRGQPISIENNLGD
FQKKLKKYLEALDNFLNFKNKQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcacagcctccccatcttgcacgttctcctgctcctgcttggactccgagccccaatg
gcacaggggcgctccttgtccacataccagcctaagcaatacttcaagatgatcagtgaa
attatggacatcttaaacaattcaccctcaccttcagaagaaaccttggacccaaatgag
acaagcaccctgctgaacactacccttctgaggccaaacctggatgcattcttgaatgct
accaaaaatttctacaacagtgaatcgctaatctggaaaaatcttaaggaattcctgcca
ctcctgcccactcccacacccagggggcaaccaatctctatcgagaataacttgggtgat
ttccaaaagaagctgaaaaagtatctggaagcccttgacaactttctgaatttcaagaac
aagcaatga

KEGG   Ursus arctos horribilis: 113261716
Entry
113261716         CDS       T05909                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04672  Intestinal immune network for IgA production
uah05140  Leishmaniasis
uah05200  Pathways in cancer
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261716 (IL4)
   04151 PI3K-Akt signaling pathway
    113261716 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261716 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261716 (IL4)
   04660 T cell receptor signaling pathway
    113261716 (IL4)
   04658 Th1 and Th2 cell differentiation
    113261716 (IL4)
   04659 Th17 cell differentiation
    113261716 (IL4)
   04657 IL-17 signaling pathway
    113261716 (IL4)
   04664 Fc epsilon RI signaling pathway
    113261716 (IL4)
   04672 Intestinal immune network for IgA production
    113261716 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261716 (IL4)
  09163 Immune disease
   05310 Asthma
    113261716 (IL4)
   05320 Autoimmune thyroid disease
    113261716 (IL4)
   05321 Inflammatory bowel disease (IBD)
    113261716 (IL4)
   05330 Allograft rejection
    113261716 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    113261716 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261716 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113261716 (IL4)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261716 (IL4)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113261716 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 113261716
NCBI-ProteinID: XP_026363735
UniProt: A0A3Q7WFH7
LinkDB
Position
Unknown
AA seq 132 aa
MGLTSQLIPALVCLLALTSTFVHGHNFSITIKEIIKTLNILTARNDTCMELTVTNIFAAP
KNTTDTETFCRATTVLRQLSTHSCSNKLLGGLHRNLKTMANMTCSVNEVKKSTLRDFLER
LKAIVQRKYYRH
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgattccagctctggtctgcttactagcactcaccagcacc
ttcgtccacggccataacttcagtattaccattaaagagatcatcaaaacgttgaacatc
ctcacagcgagaaacgacacgtgcatggagctgaccgtcaccaacatcttcgctgcccca
aagaacacaaccgatacggaaaccttctgcagagccacaactgtgcttcggcagctctct
acacacagctgctccaacaaactcctcggagggcttcacaggaacctcaagacaatggca
aacatgacctgttcggtgaatgaagtcaagaagagtacgctgagagacttcttggaaagg
ctaaaagcgatcgtgcaaaggaaatactacaggcactga

KEGG   Ursus arctos horribilis: 113264523
Entry
113264523         CDS       T05909                                 

Gene name
PRL
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04080  Neuroactive ligand-receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113264523 (PRL)
   04151 PI3K-Akt signaling pathway
    113264523 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113264523 (PRL)
   04060 Cytokine-cytokine receptor interaction
    113264523 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    113264523 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113264523 (PRL)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113264523 (PRL)
SSDB
Motif
Pfam: Hormone_1 KIAA1430
Other DBs
NCBI-GeneID: 113264523
NCBI-ProteinID: XP_026367363
UniProt: A0A3Q7WZJ9
LinkDB
Position
Unknown
AA seq 229 aa
MDKKGWSLKGSLLPLLLLVSDLLLCQSVASLPICPTGAVNCQVSLRDLFDRAVILSHYIH
NLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRS
WNDPLYHLVTEVRGMQEAPDSILSRAIEIEEQNRRLLEGMEKIVGQVHPGVRENEVYSVW
SGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC
NT seq 690 nt   +upstreamnt  +downstreamnt
atggacaaaaaagggtggtcgctgaaagggtctctcctgcccctgctgctgctggtgtcg
gacctgctcctgtgccagagcgtggcctccctgcccatctgtcccaccggggctgtcaac
tgccaggtgtccctccgagacctgtttgaccgcgcggtcattctgtctcactacatccat
aacctctcctcggagatgttcaacgaatttgataaaaggtatgcccaaggccgggggttc
attaccaaggccatcaacagctgtcacacttcctccctctctacccctgaagacaaggag
caagcccagcagatccatcacgaagaccttctgaacctgatactcagagtgctacgctcg
tggaatgaccccctgtaccatctagtcacagaagtacggggtatgcaagaagccccagat
tcgattctgtccagagccatagagattgaggaacaaaacagaagacttctagagggtatg
gagaagatagttggccaggttcatcctggagtcagagaaaatgaggtctactcggtctgg
tcaggacttccatcccttcagatggccgatgaagacacacgcctttttgctttttataac
ctgctccactgcctacgcagggattcacataagattgacaattatctcaagctcctgaag
tgccgcatcgtctacgacagcaactgctaa

KEGG   Ursus arctos horribilis: 113265156
Entry
113265156         CDS       T05909                                 

Definition
(RefSeq) somatotropin
  KO
K05438  growth hormone
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04080  Neuroactive ligand-receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113265156
   04151 PI3K-Akt signaling pathway
    113265156
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113265156
   04060 Cytokine-cytokine receptor interaction
    113265156
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    113265156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113265156
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113265156
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 113265156
NCBI-ProteinID: XP_026368046
UniProt: A0A3Q7W4J7
LinkDB
Position
Unknown
AA seq 245 aa
MFSVPGGRGRAGRKQASCRLGPSLALCVPPCVDPQSSVLLAFALLCLPWPQEVGAFPAMP
LSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDE
AQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRE
LEDGSPRAGQILKPTYDKFDTSLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVE
SSCAF
NT seq 738 nt   +upstreamnt  +downstreamnt
atgttctcagtccctggggggaggggaagggctggcaggaaacaggcctcttgccgtctg
ggccccagccttgccctctgtgtccctccgtgtgtagaccctcagagctctgtgctcctg
gccttcgccctgctctgcctgccttggcctcaggaggtgggcgccttcccggccatgccc
ttgtccagcctgtttgctaacgctgtgctccgggcccagcacctgcaccagctggctgcc
gacacctacaaagagtttgagcgtgcgtacatcccggagggccagaggtattccatccag
aatgcgcaggccgccttctgcttctcggagaccatcccggcccccacgggcaaggacgag
gcccagcagagatccgacgtggagctgctgcgcttctccctgctgctcatccagtcgtgg
ctcgggcccgtgcagttcctcagcagggtcttcaccaacagcctggtgttcggcacctca
gaccgagtctacgagaagctgaaggacctggaggaaggcatccaagcgctgatgcgggag
ctagaagacggcagcccccgggctgggcagatcctgaagccaacgtatgacaagtttgac
acaagcctgcgcagcgacgacgcactgctcaagaactacgggctgctctcctgcttcaag
aaggacctgcacaaggctgagacctacctgcgggtcatgaagtgtcgtcgcttcgtggaa
agcagctgtgccttctag

KEGG   Ursus arctos horribilis: 113265687
Entry
113265687         CDS       T05909                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor
  KO
K05423  granulocyte colony-stimulating factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04657  IL-17 signaling pathway
uah05144  Malaria
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113265687 (CSF3)
   04151 PI3K-Akt signaling pathway
    113265687 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113265687 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113265687 (CSF3)
   04657 IL-17 signaling pathway
    113265687 (CSF3)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    113265687 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113265687 (CSF3)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113265687 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL6
Other DBs
NCBI-GeneID: 113265687
NCBI-ProteinID: XP_026369019
UniProt: A0A3Q7XQE4
LinkDB
Position
Unknown
AA seq 195 aa
MKLTALQLLLWQSALWLVQEASPPGPGSSLPQSFLLKCFEQMRKVQADGTALQERLCATY
KLCHPEELVLLGHALGIPQPPLSSCSSQALQLTGCLRQLHGGLFLYQGLLQALAGISPEL
APTLDTLQLDISDFAVNIWQQMEELGVAPAVPPTQGTMPTFTSSFQRRAGGVLVTSDLQS
FLELAYRALRSFAKP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctgacggccctgcagctgttgctgtggcaaagcgcactctggctagtgcaagaa
gccagccccccgggcccgggcagctccctgccccagagcttcctgctcaagtgtttcgag
caaatgaggaaggtccaggctgacggcacagcgctgcaggagaggctgtgtgccacctac
aagctgtgccaccccgaggagctggtgctgctgggacacgctctgggcatcccccagcct
ccgctgagcagctgctccagccaggccctgcagctgacgggctgcctgcgccaactccac
ggcggcctcttcctgtaccagggcctcctgcaggctctggcggggatatcccccgagctg
gcccccaccttggacacgctgcagctggacatcagcgactttgccgtcaacatctggcag
cagatggaagagctgggggtggccccggcagtgccgcccacccagggaaccatgccaacc
ttcacctcgtccttccagcgccgggcgggaggggtcctggtgacctccgacctgcagagc
ttcctggagctggcctaccgcgctctgcgctcctttgccaaaccctga

KEGG   Ursus arctos horribilis: 113267523
Entry
113267523         CDS       T05909                                 

Gene name
EPO
Definition
(RefSeq) LOW QUALITY PROTEIN: erythropoietin
  KO
K05437  erythropoietin
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04066  HIF-1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113267523 (EPO)
   04066 HIF-1 signaling pathway
    113267523 (EPO)
   04151 PI3K-Akt signaling pathway
    113267523 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113267523 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113267523 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113267523 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113267523 (EPO)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113267523 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 113267523
NCBI-ProteinID: XP_026371318
UniProt: A0A3Q7XAB8
LinkDB
Position
Unknown
AA seq 277 aa
MNRLGKYSLNLDAYDWDLGGKRNRALKAKQGWEAAWVLRGKLGPEARQDVRTGSQYARTE
EGLQSRLERSGTCEPAPPXPTHSVWHSFLECPALLLLLSLLLLPLGLPVLGAPPRLICDS
RVLERYILEAREAENVTMGCAQGCSFSENITVPDTKVNFYTWKRMDVGQQAVEVWQGLAL
LSEAILRGQALLANSSQLSETLRLHVDKAISSLRSLTSLLRALGAQKEAISLPEEASAAP
LRTFTVDTLCKLFRIYSNFLRGKLTLYTGEACRRGDR
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaccgtttgggaaaatactcgctaaatctggatgcttacgactgggatctgggaggg
aagcggaaccgggctctgaaggccaagcagggctgggaagctgcctgggtgctgagaggg
aaactgggaccagaggcacggcaggatgtgcggactgggagtcagtatgccaggactgag
gagggactccagagcaggctggagaggagcggaacgtgtgaaccggcccctccanaaccc
acacactcagtctggcactcttttctagaatgtcctgccctgctgcttctgctgtccttg
ctgctgcttcctctgggcctcccagtcctgggcgccccccctcgcctcatttgtgacagc
cgagtcctggagaggtacatcctggaggccagggaggccgaaaatgtcacgatgggctgt
gctcaaggctgcagcttcagcgagaatatcaccgtcccagacaccaaggttaatttctac
acctggaagaggatggacgtcgggcagcaggccgtggaagtctggcagggcctggccctg
ctctcagaagccatcctgcggggccaggccctgttggccaactcctcgcagctgtctgag
accctgcggttgcacgtggacaaagccatcagcagcctgcgcagcctcacctccctgctt
cgggcgctgggagcccagaaggaggccatctcccttccagaggaagcctctgctgctcca
ctccgaacattcactgttgatactttgtgcaaacttttccgaatctactccaatttcctg
cggggaaagctgacgctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system