KEGG   Ursus arctos horribilis: 113245327
Entry
113245327         CDS       T05909                                 

Gene name
CRTC2
Definition
(RefSeq) CREB-regulated transcription coactivator 2 isoform X1
  KO
K16333  CREB-regulated transcription coactivator 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04922  Glucagon signaling pathway
uah04931  Insulin resistance
uah05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113245327 (CRTC2)
   04152 AMPK signaling pathway
    113245327 (CRTC2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    113245327 (CRTC2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    113245327 (CRTC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113245327 (CRTC2)
SSDB
Motif
Pfam: TORC_M TORC_C TORC_N
Other DBs
NCBI-GeneID: 113245327
NCBI-ProteinID: XP_026341133
UniProt: A0A3Q7UWS4
LinkDB
Position
Unknown
AA seq 724 aa
MATAGANGPGSATAAASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLA
YTRGPHYGGSLPNVNQIGCGLAEFQSPLHSPLDSSRGTRHHGLVERVQRDPRRMVSPLRR
YPRHVDSSPYSPAYLSPPPESSWRRTMPWGSFPAEKGQLFRLPSALNRTSSDSALHTSVM
NPSPQDTYPGPAPPSLLPSRRGGFLDGDVDSKVFLFQVPAIEENLLDDKHLLKPWDAKKL
SSSSSRPRSCEVPGINIFPSPDQPASVPVLPPAMNTGGSLPDLTSLHFPPPLPTPLDPED
TAYPSLSGGNSTSNLTHTMTHLGISGGLGLGPGYDAPGLHSPLSHPSLQSSLSNPNLQAS
LSSAQPQLQGSHSHPSLPASSLARHALPTASLGHPSLSAPALSSSTSSSSASSPVLGAPP
YPASTPGTSPRHRRVPLSPLSLPAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTS
RLSTDQRLPPCPYSPPSLVLPSQPPTPKPLQQPGLSSQACSMQPSGGQPPGRPPHYGTLY
PPSSSGHGQQSYHRSVSDFGLGNLSPRRVLFDGRSDLFSSWHAHALSRQLEQFSMESPST
SLALDPPGFSEGPGFLGGEGPVSSLQDPHALNHQNLTHCSHHASGPNIILPGEASPGFSK
EIAAALAGVPGFEVSAAGLGLGLGLEEDLRMEPLGLEGLHMLSDPCALLPDPAVEDSFRS
DRLQ
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggcgacggcgggcgcgaacgggcccggctcggccacggccgcagcttccaatccgcgc
aagttcagcgagaagatcgcgctgcagaagcagcgtcaggccgaagagactgcggccttc
gaggaggtgatgatggacatcggctccacccggttacaggcccagaagctgcggctggcg
tacacaaggggcccccattacggcggctctctgcccaatgttaaccagattggctgtggc
ttggccgagttccagagccccctccactcgcctctggattcgtctcggggcactcggcac
catgggctggtggagcgagtgcagcgagaccctcgaaggatggtgtccccgctccgccgc
tacccccgccacgtcgacagctctccctacagtcctgcctacttgtctcctcccccggag
tccagctggcggaggacgatgccctggggcagtttccctgcagagaagggccagttgttt
cgactaccatctgcactgaacaggacaagttccgactctgcccttcacaccagtgtgatg
aaccccagccctcaggacacttatccaggccctgcccctcccagcctcctgcccagccgc
cgtggaggttttctggacggtgacgtggactccaaagtctttctctttcaagtccctgct
attgaggagaacttgctggatgacaagcatttgctgaagccatgggatgctaagaagctg
tcctcatcctcctcccgacctcggtcctgtgaagtccctggaattaacatcttcccatct
cctgaccagcctgccagtgtgcccgtcctccctcctgccatgaacaccggcggctccctt
cctgacctcaccagcctgcactttcccccgccactgcccactcccctggaccctgaggac
acagcctaccccagcctgagtgggggcaacagtacctccaatttgacccacaccatgacc
cacctcggcatcagcgggggcctgggcctgggcccgggctatgatgcaccaggacttcac
tcccctctcagccacccatccctgcagtcctccctgagcaatcccaacctccaggcctcc
ctgagcagtgcccagccgcagctccagggctcccacagccacccctccctgcctgcatcc
tccctggcccgccacgcactgcccaccgcctccctgggccacccctcgctcagtgccccg
gccctctcctcctccacttcttcctcctctgcttcatctcccgtgctgggtgccccccct
tacccagcttctacccccggaacttccccccgccaccgccgtgtgcccctcagccccctg
agtttgcccgcgggcccagctgacgccagaaggtcccaacagcagctgcccaaacagttt
tcgccaacaatgtcacccaccttgtcctccatcactcagggtgtacccctggataccagc
agactgtccactgaccagcggctgcctccatgcccatacagccccccaagtttggttctg
cccagccagccacccaccccaaagcctctgcagcagccagggctgtcctctcaggcctgc
tccatgcagccctcaggtgggcagcccccaggccggccaccgcactatgggacactgtac
ccacccagctccagtgggcacgggcagcagtcctaccaccggtcagtgagtgacttcggc
ctggggaacctgtctccgcgccgcgtgctctttgatggccgctctgacttgttctcttcc
tggcatgcacacgctctgtcgcggcagctggagcagttcagcatggagagcccatcaacc
agcctggcgctggatccccctggcttttctgaagggcctggatttttagggggtgagggg
ccagtgagtagtcttcaggacccccatgccctcaaccaccagaacttgacccactgttcc
caccatgcctcagggcccaacatcattctcccaggagaggcctccccaggtttctctaag
gagattgcagcggccctggccggagtgcctggctttgaggtgtcggcggctgggctgggg
ctgggacttgggctggaggaggatctgcgcatggagccactgggcctggaagggctccac
atgctgagcgacccctgtgccctgctgcccgaccctgctgtggaggactcattccgcagt
gaccggctgcagtga

DBGET integrated database retrieval system