KEGG   Ursus arctos horribilis: 113245546
Entry
113245546         CDS       T05909                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
uah  Ursus arctos horribilis
Pathway
uah01523  Antifolate resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
uah04068  FoxO signaling pathway
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04668  TNF signaling pathway
uah04722  Neurotrophin signaling pathway
uah04910  Insulin signaling pathway
uah04920  Adipocytokine signaling pathway
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah05010  Alzheimer disease
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05206  MicroRNAs in cancer
uah05212  Pancreatic cancer
uah05215  Prostate cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113245546 (IKBKB)
   04010 MAPK signaling pathway
    113245546 (IKBKB)
   04064 NF-kappa B signaling pathway
    113245546 (IKBKB)
   04668 TNF signaling pathway
    113245546 (IKBKB)
   04068 FoxO signaling pathway
    113245546 (IKBKB)
   04151 PI3K-Akt signaling pathway
    113245546 (IKBKB)
   04150 mTOR signaling pathway
    113245546 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113245546 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113245546 (IKBKB)
   04621 NOD-like receptor signaling pathway
    113245546 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    113245546 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    113245546 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    113245546 (IKBKB)
   04660 T cell receptor signaling pathway
    113245546 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    113245546 (IKBKB)
   04659 Th17 cell differentiation
    113245546 (IKBKB)
   04657 IL-17 signaling pathway
    113245546 (IKBKB)
   04662 B cell receptor signaling pathway
    113245546 (IKBKB)
   04062 Chemokine signaling pathway
    113245546 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113245546 (IKBKB)
   04920 Adipocytokine signaling pathway
    113245546 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113245546 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113245546 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113245546 (IKBKB)
   05206 MicroRNAs in cancer
    113245546 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113245546 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    113245546 (IKBKB)
   05221 Acute myeloid leukemia
    113245546 (IKBKB)
   05220 Chronic myeloid leukemia
    113245546 (IKBKB)
   05215 Prostate cancer
    113245546 (IKBKB)
   05222 Small cell lung cancer
    113245546 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113245546 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113245546 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113245546 (IKBKB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113245546 (IKBKB)
   04931 Insulin resistance
    113245546 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113245546 (IKBKB)
   05135 Yersinia infection
    113245546 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113245546 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    113245546 (IKBKB)
   05162 Measles
    113245546 (IKBKB)
   05164 Influenza A
    113245546 (IKBKB)
   05161 Hepatitis B
    113245546 (IKBKB)
   05160 Hepatitis C
    113245546 (IKBKB)
   05168 Herpes simplex virus 1 infection
    113245546 (IKBKB)
   05163 Human cytomegalovirus infection
    113245546 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113245546 (IKBKB)
   05169 Epstein-Barr virus infection
    113245546 (IKBKB)
   05165 Human papillomavirus infection
    113245546 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113245546 (IKBKB)
   05142 Chagas disease (American trypanosomiasis)
    113245546 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    113245546 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113245546 (IKBKB)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     113245546 (IKBKB)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   113245546 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo APH YrbL-PhoP_reg ubiquitin Med20 Glyco_hydro_65m
Other DBs
NCBI-GeneID: 113245546
NCBI-ProteinID: XP_026341453
UniProt: A0A3Q7UXC0
LinkDB
Position
Unknown
AA seq 756 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AVLTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGAVKFSSSLPYPNNLNSILAQRLEKWLQLMLMWHPRQRGTDPVYGPNGCF
KALDDILNLKLVHILNMVTGIIHTYPVTEDESLQSLQARIQQDTGIPEKDQELLQEAGLA
LIPDKPATQCISDGKLNEGRTLDMDLVFLFNNSKIAYETQISPRPQPESVSCILQEPKRN
LSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEHAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHSGQLLSQPSAAPNSLPEAIKKSEELVAEAHTLCAQLE
NAMQDTIKEQDQSWRSLDWSWLQTEEEEQNSLEQAS
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttctctgccaacccagacatgtggggcctgggagatgaaagaacga
cttgggacagggggatttggaaacgtcatccgatggcacaatcaggagacaggggagcag
attgctatcaagcagtgccggcaggagctcagcccccggaaccgagaacgctggtgcctg
gagatccagatcatgagaaggctgaaccaccccaatgtggtggctgcccgggacgtcccc
gaggggatgcagaacttggctcccaatgacttgcccctgttggccatggagtactgccag
ggaggagatctccgaaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccgtcctcaccctgctgagtgacattgcctctgcacttagataccttcacgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagagcaaagatta
atacacaaaattattgacctaggatatgccaaggaactggatcagggcagtctttgtact
tcctttgtggggaccctgcaatacctggccccagaactcctggagcagcagaagtacacg
gtgaccgtggactactggagcttcggcaccttggctttcgagtgcatcacgggcttccga
ccttttctccctaactggcagcccgtgcagtggcattccaaagtccggcagaagagtgag
atggacattgtcgtcagtgaggacttgaatggagcggtgaagttttcaagctccttaccc
taccccaataatctgaacagcatcctggcacagcggctggagaagtggctgcagctgatg
ctgatgtggcacccacggcaaaggggcaccgatcctgtgtacgggcccaacggctgcttc
aaggccctggatgacatcttaaacctgaagctagttcatatcttgaacatggtcacaggc
atcattcacacctatccagtgacagaggacgagagtctgcagagcttgcaggccagaatc
cagcaagacacaggaatccccgagaaggaccaggagctgctgcaggaagctgggctggcg
ctgatccctgacaagcctgccactcagtgtatttcagatggcaagctgaatgagggccgc
acgctggacatggatctcgtctttctctttaacaacagtaaaattgcctatgagactcag
atctctccccggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaac
ctgtctttcttccagctgaggaaggtgtggggccaggtctggcacagcatccaaaccctg
aaggaggactgtaaccgactgcaacagggacagcgagctgccatgatgaatctccttcgg
aataatagctgcctctccaagatgaagaattctatggcttccatgtctcagcagctcaaa
gccaaattggatttctttaaaaccagcatccagattgacctggagaagtacagtgagcaa
actgagtttggaatcacatcagataagctgctgctggcctggagggagatggagcacgct
gtggagctctgtgggcgggagaatgaagtgaagcacctggtggagcggatgatggcgctg
cagaccgacatcgtggacctgcagaggagcccgatggggcggaagcagggcggcacgctg
gacgacctagaagagcaggcaagggagctctacaggagacttcgggagaaacccagagac
cagcgaacggacggcgacagtcaggagatggtccggctgctccttcaggccatccaaggc
tttgagaagaaagtgcgagtgatttatacacagctcagtaaaactgtggtttgcaagcag
aaggctctggaattattgcccaaggtggaagaggtggtgagtttaatgaacgaagatgag
aagactgttgtccggcttcaggagaagcggcagaaggagctctggaatctgctgaagatc
gcttgcagcaaagtccgtggccctgtcagcggaagcccagacagcatgaatgcttctcgc
ctcagtcactcgggtcagctgctgtctcagccttctgctgcccccaacagcctacccgag
gccatcaagaaaagtgaagaactggtggctgaagcacatactctctgcgcccagctagaa
aacgcaatgcaagacaccataaaagaacaggaccagagttggaggtctctagactggagc
tggttacagacggaagaagaagagcagaatagcctggaacaggcctcttga

KEGG   Ursus arctos horribilis: 113247832
Entry
113247832         CDS       T05909                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
uah  Ursus arctos horribilis
Pathway
uah01523  Antifolate resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04668  TNF signaling pathway
uah04920  Adipocytokine signaling pathway
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05212  Pancreatic cancer
uah05215  Prostate cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05340  Primary immunodeficiency
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113247832 (IKBKG)
   04010 MAPK signaling pathway
    113247832 (IKBKG)
   04064 NF-kappa B signaling pathway
    113247832 (IKBKG)
   04668 TNF signaling pathway
    113247832 (IKBKG)
   04151 PI3K-Akt signaling pathway
    113247832 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113247832 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113247832 (IKBKG)
   04621 NOD-like receptor signaling pathway
    113247832 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    113247832 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    113247832 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    113247832 (IKBKG)
   04660 T cell receptor signaling pathway
    113247832 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    113247832 (IKBKG)
   04659 Th17 cell differentiation
    113247832 (IKBKG)
   04657 IL-17 signaling pathway
    113247832 (IKBKG)
   04662 B cell receptor signaling pathway
    113247832 (IKBKG)
   04062 Chemokine signaling pathway
    113247832 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113247832 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113247832 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113247832 (IKBKG)
   05203 Viral carcinogenesis
    113247832 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113247832 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    113247832 (IKBKG)
   05221 Acute myeloid leukemia
    113247832 (IKBKG)
   05220 Chronic myeloid leukemia
    113247832 (IKBKG)
   05215 Prostate cancer
    113247832 (IKBKG)
   05222 Small cell lung cancer
    113247832 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    113247832 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113247832 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113247832 (IKBKG)
   05135 Yersinia infection
    113247832 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113247832 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    113247832 (IKBKG)
   05162 Measles
    113247832 (IKBKG)
   05164 Influenza A
    113247832 (IKBKG)
   05161 Hepatitis B
    113247832 (IKBKG)
   05160 Hepatitis C
    113247832 (IKBKG)
   05168 Herpes simplex virus 1 infection
    113247832 (IKBKG)
   05163 Human cytomegalovirus infection
    113247832 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113247832 (IKBKG)
   05169 Epstein-Barr virus infection
    113247832 (IKBKG)
   05165 Human papillomavirus infection
    113247832 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113247832 (IKBKG)
   05142 Chagas disease (American trypanosomiasis)
    113247832 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    113247832 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113247832 (IKBKG)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   113247832 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1
Other DBs
NCBI-GeneID: 113247832
NCBI-ProteinID: XP_026344936
UniProt: A0A3Q7W3U4
LinkDB
Position
Unknown
AA seq 419 aa
MSRPPWKSQLCEMVQPSGGPAGDQEVLGEESSLGKPAMLHLPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEARKLVERLSLEKLDLRRQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSMVSSERNRGMQLEDLKLQLQQAEEALVAKQEVIDKLKEEAEQHKMVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEFLQEQLEQLQREYSRLKASCQESARIEDLRKRH
VEVSQAPLPPTPAHPSFHLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagctgtgtgagatggtgcagcccagtggtggcccg
gcaggggaccaggaagtgctgggtgaagaatcttctctggggaagccagctatgctccac
ctaccttctgagcagggcactcctgagaccttccaacgctgtctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgcttcgggagcgctgtgaggaactgcag
cgtttccaaggcagccagaggaaggagaaggagttcctcatgcagaaattccaagaagcc
aggaaactggtagaaagactgagcctggagaaactcgacctgaggaggcagagggagcag
gccctgcaggaggtggaacatctgaagagatgccagcagcagatggctgaggacaaggcc
tccgtgaaagcccaggtgacatccttgctgggggagctccaagagagccagagtcgtttg
gaggctgccaccaaggagcggcaggctttggagggcagggcccgggctgccagcgagcag
gcccggcagctggagagcgagcgggaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggcggccctgcgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagctacaggtggcctatcaccagctcttccaagag
tatgacaaccacatcaagagcagcatggtgagcagtgagcgaaaccgaggaatgcagctg
gaggatctcaagctgcagctccagcaggccgaggaggccctggtggccaagcaggaagtg
attgacaagctgaaggaagaggctgagcagcacaagatggtgatggagactgtcccggtg
ctaaaggctcaggcggatatctacaaggcagacttccaggccgagaggcaggcccgggag
aaactggctgagaagaaggagttcctgcaggagcagctggagcagctgcagagggagtac
agcaggctgaaggccagctgtcaggagtcggccaggattgaagatcttaggaagcggcat
gtggaggtctcccaggcccccttaccccccaccccagctcacccttcctttcacctggcc
ctgcccagccagaggagaagcccgcccgaggagccacctgacttctgttgccccaagtgc
cagtatcaggctcctgatatggacaccctgcagatacatgtcatggagtgcatcgagtag

KEGG   Ursus arctos horribilis: 113251823
Entry
113251823         CDS       T05909                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
uah  Ursus arctos horribilis
Pathway
uah01523  Antifolate resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
uah04068  FoxO signaling pathway
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04668  TNF signaling pathway
uah04920  Adipocytokine signaling pathway
uah05010  Alzheimer disease
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05212  Pancreatic cancer
uah05215  Prostate cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05222  Small cell lung cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113251823 (CHUK)
   04010 MAPK signaling pathway
    113251823 (CHUK)
   04064 NF-kappa B signaling pathway
    113251823 (CHUK)
   04668 TNF signaling pathway
    113251823 (CHUK)
   04068 FoxO signaling pathway
    113251823 (CHUK)
   04151 PI3K-Akt signaling pathway
    113251823 (CHUK)
   04150 mTOR signaling pathway
    113251823 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113251823 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113251823 (CHUK)
   04621 NOD-like receptor signaling pathway
    113251823 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    113251823 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    113251823 (CHUK)
   04625 C-type lectin receptor signaling pathway
    113251823 (CHUK)
   04660 T cell receptor signaling pathway
    113251823 (CHUK)
   04658 Th1 and Th2 cell differentiation
    113251823 (CHUK)
   04659 Th17 cell differentiation
    113251823 (CHUK)
   04657 IL-17 signaling pathway
    113251823 (CHUK)
   04662 B cell receptor signaling pathway
    113251823 (CHUK)
   04062 Chemokine signaling pathway
    113251823 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113251823 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113251823 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113251823 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113251823 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    113251823 (CHUK)
   05221 Acute myeloid leukemia
    113251823 (CHUK)
   05220 Chronic myeloid leukemia
    113251823 (CHUK)
   05215 Prostate cancer
    113251823 (CHUK)
   05222 Small cell lung cancer
    113251823 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113251823 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113251823 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113251823 (CHUK)
   05135 Yersinia infection
    113251823 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113251823 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    113251823 (CHUK)
   05162 Measles
    113251823 (CHUK)
   05164 Influenza A
    113251823 (CHUK)
   05161 Hepatitis B
    113251823 (CHUK)
   05160 Hepatitis C
    113251823 (CHUK)
   05168 Herpes simplex virus 1 infection
    113251823 (CHUK)
   05163 Human cytomegalovirus infection
    113251823 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113251823 (CHUK)
   05169 Epstein-Barr virus infection
    113251823 (CHUK)
   05165 Human papillomavirus infection
    113251823 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113251823 (CHUK)
   05142 Chagas disease (American trypanosomiasis)
    113251823 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    113251823 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113251823 (CHUK)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     113251823 (CHUK)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   113251823 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 113251823
NCBI-ProteinID: XP_026349648
UniProt: A0A3Q7VKU0
LinkDB
Position
Unknown
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDVKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKARDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVRDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVVSSLEGAVTPQASAWLPPTSTEREHPLSCVVTPQDGETIAQMIEENLNCLGHL
STIIREGNEEQGSRMMNLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccgtgggagatgcgggagcgg
ctaggcaccggcggctttgggaatgtctgcctgtaccagcatcgggaacttgatgtcaaa
atagcaattaagtcatgtcgcctagaactaagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgccaatgttgtaaaggcccgtgatgtacct
gaggaattgaattttttaattaatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccggaagttactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagtgatatagggtctgggatccgatatttgcatgaaaacaaaatt
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggtggaaagattatg
cataaaataattgatctggggtatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcaatatctggccccagaactctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgacaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggcttcagttgatgctg
aattgggatcctcagcaaagaggaggaccggtagatcttactttgaagcagccaagatgt
tttgtattaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttttgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagagctgctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagtcagaggttgtgat
agctatatggtgtatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacgggacagcaaaatacagcttccaatt
atacagctgcgtaaagtatgggctgaagcagtacactatgtgtctgggctaaaagaagac
tacagcaggctctttcagggacaaagagcagcaatgttaagtcttcttcgatacaatgct
aacttgacaaaaatgaagaacactttgatctcagcatctcagcaactgaaagctaaattg
gagtttttccacaaaagcattcagcttgacttggaaagatacagtgagcagatgacttat
gggatatcctcagaaaaaatgttaaaagcgtggaaggaaatggaagaaaaggctatccac
tatgctgaggtgggtgtcattggttacctggaggatcagatcatgtccctgcacactgaa
atcatggagctgcagaagagcccttatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctgtataagcagttaaagcacagaccttcagatcactcctac
agcgacagcacggaaatggtaaagatcattgtgcatactgttcagagtcaggaccgggtt
ctcaaggagctgtttggtcatctgagcaagttactgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtaacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagagacagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtagtatccagtctagaaggtgcagtaacccctcaggcatca
gcatggcttcccccaacttcaacagaacgtgaacatcctctgtcatgtgtggtaactcct
caagatggggagactatagcacaaatgatagaagaaaatttgaactgtcttggccattta
agcactattattcgtgaaggaaatgaggaacagggcagtagaatgatgaatcttgattgg
agttggttaacagaatga

DBGET integrated database retrieval system