KEGG   Ursus arctos horribilis: 113245994Help
Entry
113245994         CDS       T05909                                 

Definition
(RefSeq) granzyme B-like isoform X1
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
uah  Ursus arctos horribilis
Pathway
uah04210  Apoptosis
uah04650  Natural killer cell mediated cytotoxicity
uah04940  Type I diabetes mellitus
uah05202  Transcriptional misregulation in cancer
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113245994
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113245994
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    113245994
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113245994
   05330 Allograft rejection
    113245994
   05332 Graft-versus-host disease
    113245994
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113245994
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:uah01002]
    113245994
Enzymes [BR:uah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     113245994
Peptidases and inhibitors [BR:uah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   113245994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 113245994
NCBI-ProteinID: XP_026342183
UniProt: A0A3Q7UZF4
LinkDB All DBs
Position
Unknown
AA seq 260 aa AA seqDB search
MQPFLLLLPLAFCLPSGAKAGEIIGGHEAKAHSRPYMAYLRIQNQDGETTCGGFLIQETF
VLTAAHCSGSSIKVTLGAHNIQKQEKTQQVIPVKTAIPHPDYSPKNHSNDIMLLKLERKA
QQTAAVRPLRLPGTKNRVRPGQVCSVAGWGRVDAQIRRYPDTLQEVRLTVQDDQECKSRF
PKYYDRTIQLCVGDPNEKKSSFRGDSGGPLVCNNVAQGIVSFGRKEGTPPRVYTKISSFL
PWIKKTMKSPYLQELDYLLR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccttcctgctcctgctcccgctggccttttgcctgccttccggggccaaggca
ggagagatcatcgggggacatgaggccaaggcccactcccggccctatatggcatatctt
aggatccagaatcaggatggggagactacgtgtggagggttcctgatacaggagaccttc
gtgctgaccgccgctcactgctcgggaagctccatcaaggtcaccctgggggcccacaac
atccagaaacaggagaagacccagcaggtcatccccgtgaaaacagccatcccccaccca
gactatagtccgaagaaccactccaatgacatcatgttactgaagctggagagaaaggcc
cagcagactgccgctgtgaggcccctccgcctgcccgggaccaagaaccgggtgaggcca
ggacaggtgtgcagtgtggccggctgggggcgggtcgacgcccagatacgcaggtaccca
gacactctgcaggaggtgaggctgacggtgcaggacgatcaggagtgcaaatcccgcttc
cccaagtattacgaccgcaccattcagctgtgcgtgggggacccgaacgaaaagaagtct
tcctttcggggcgactctgggggccctctcgtgtgtaacaatgtggctcagggcattgtc
tcctttggacgaaaagaggggacacctccacgtgtctacaccaaaatctcaagtttcctg
ccctggataaagaaaaccatgaaaagtccctacctgcaggaactagactatttgctccgc
tga

DBGET integrated database retrieval system