KEGG   Ursus arctos horribilis: 113246063
Entry
113246063         CDS       T05909                                 

Gene name
PCK2
Definition
(RefSeq) phosphoenolpyruvate carboxykinase [GTP], mitochondrial
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
uah  Ursus arctos horribilis
Pathway
uah00010  Glycolysis / Gluconeogenesis
uah00020  Citrate cycle (TCA cycle)
uah00620  Pyruvate metabolism
uah01100  Metabolic pathways
uah03320  PPAR signaling pathway
uah04068  FoxO signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04910  Insulin signaling pathway
uah04920  Adipocytokine signaling pathway
uah04922  Glucagon signaling pathway
uah04931  Insulin resistance
uah04964  Proximal tubule bicarbonate reclamation
Module
uah_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113246063 (PCK2)
   00020 Citrate cycle (TCA cycle)
    113246063 (PCK2)
   00620 Pyruvate metabolism
    113246063 (PCK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113246063 (PCK2)
   04151 PI3K-Akt signaling pathway
    113246063 (PCK2)
   04152 AMPK signaling pathway
    113246063 (PCK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113246063 (PCK2)
   04922 Glucagon signaling pathway
    113246063 (PCK2)
   04920 Adipocytokine signaling pathway
    113246063 (PCK2)
   03320 PPAR signaling pathway
    113246063 (PCK2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    113246063 (PCK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    113246063 (PCK2)
Enzymes [BR:uah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     113246063 (PCK2)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 113246063
NCBI-ProteinID: XP_026342290
UniProt: A0A3Q7UQ94
LinkDB
Position
Unknown
AA seq 640 aa
MAAVYRPGLRLRWPGLSPWGWSSWRSIQTLRVLSGDLGQLPAGVRDFVERSARLCRPEGI
HICDGTEAENTATLTLLEKQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTV
PLPAGGARGQLGNWMSPADFQQAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTD
SAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGHPLTGQGEPVNQWPCNPEKTLIGHV
PDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAA
AFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSDGRLRAINPENGFFGVAPGTSAT
TNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKEPCAHP
NSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFSWRHGVFVGSAMRS
ESTAAAEHKGKIIMHDPFAMRPFFGYNFGRYLEHWLSMEERKGARLPRIFHVNWFRRDEA
GRFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLGAIDTTQLFSLPK
DFWEQEVHDIRSYLTEQVNQDLPKEVLAELEALEGRVRRM
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggccgctgtgtaccgccccggcctgcggcttcgctggcctgggctgagcccctggggc
tggtcatcatggcgcagcatccagaccctgcgagtactcagtggagatctgggccagctg
cctgctggggtgcgagactttgtggagcgcagtgcccgcctgtgccgaccagagggcatc
cacatctgtgatggcaccgaggctgagaacactgccacgctgaccctcctggaaaagcag
ggacttatccgaaagctccccaagtacaacaactgctggctggcccgcacagaccccaag
gatgtggcacgagtagagagcaagacggtgattgtaactccttctcaacgggacacagtg
cccctccccgctggtggggcccgtgggcaactaggcaactggatgtccccagctgacttc
cagcaagctgtggatgagaggtttccaggctgcatgcagggccgaaccatgtacgtgctt
ccgttcagcatgggtcccgtgggctccccactgtcccgcatcggagtgcagctcactgac
tcggcctatgtggtagcaagcatgcgtattatgacccggctggggacacccgtgcttcag
gccctgggagatggcgactttgtcaagtgtctacactctgtgggccaccccctgactggg
caaggggagccagtgaaccagtggccgtgcaacccagagaaaaccctgattggccacgtg
cctgaccagcgggagatcatctccttcggcagcggctatggtggcaactccttgctgggc
aagaagtgctttgcccttcgcatcgcctctcggctggcccgggatgagggctggctggcc
gagcacatgctgatcctgggtatcaccaaccccgcggggaagaagcgctatgtggcggct
gccttccccagtgcctgcggcaagactaacctggccatgatgcggccagcactgccgggc
tggaaggtggagtgtgtgggggatgacatcgcctggatgaggtttgacagtgatggtcga
ctccgggccatcaaccctgagaatggcttcttcggggtggcccctggcacctcagccacc
accaatcctaatgccatggccacaatccagagtaacactctattcaccaatgtggctgag
accagcgatggtggagtgtactgggagggcattgaccagcctcttccacccggtgtcacc
gtgacctcctggctgggcaaaccctggaaacctggagacaaggagccctgtgcacatccc
aactctcgcttttgtgccccggctcgccagtgcccaatcatggacccagcctgggaggcc
cccgagggtgtccccattgatgccatcatctttggaggccgcagacccaaaggagtaccc
ctggtatacgaggccttcagctggcgccacggggtgtttgtgggcagtgccatgcgctct
gagtccactgctgcggctgaacacaaagggaagatcatcatgcacgacccatttgccatg
cggcccttttttggctacaactttgggcgctacctagaacattggctgagcatggaggag
cgcaagggggcccggctgccccgcattttccatgtcaactggttccggcgggacgaggcg
ggccgcttcctgtggccaggctttggagagaatgctcgggtgctagactggatctgccgg
cggctagagggagaggacagtgcccgagagacgcccattgggctggtgccgaaggaaggc
gccttggatctcagcggcctgggagccatagacaccacccagctgttctcgctcccgaag
gacttctgggaacaggaggttcatgacattcggagctacctgacagagcaagtcaatcaa
gatctacccaaagaggtgttggctgaactggaggccctggagggacgtgtgcgcagaatg
tga

KEGG   Ursus arctos horribilis: 113258758
Entry
113258758         CDS       T05909                                 

Gene name
PCK1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
uah  Ursus arctos horribilis
Pathway
uah00010  Glycolysis / Gluconeogenesis
uah00020  Citrate cycle (TCA cycle)
uah00620  Pyruvate metabolism
uah01100  Metabolic pathways
uah03320  PPAR signaling pathway
uah04068  FoxO signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04910  Insulin signaling pathway
uah04920  Adipocytokine signaling pathway
uah04922  Glucagon signaling pathway
uah04931  Insulin resistance
uah04964  Proximal tubule bicarbonate reclamation
Module
uah_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113258758 (PCK1)
   00020 Citrate cycle (TCA cycle)
    113258758 (PCK1)
   00620 Pyruvate metabolism
    113258758 (PCK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113258758 (PCK1)
   04151 PI3K-Akt signaling pathway
    113258758 (PCK1)
   04152 AMPK signaling pathway
    113258758 (PCK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113258758 (PCK1)
   04922 Glucagon signaling pathway
    113258758 (PCK1)
   04920 Adipocytokine signaling pathway
    113258758 (PCK1)
   03320 PPAR signaling pathway
    113258758 (PCK1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    113258758 (PCK1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    113258758 (PCK1)
Enzymes [BR:uah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     113258758 (PCK1)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N CSTF_C
Other DBs
NCBI-GeneID: 113258758
NCBI-ProteinID: XP_026359578
UniProt: A0A3Q7WD52
LinkDB
Position
Unknown
AA seq 622 aa
MPPQLQNGLSFSAKVIQGTLDSLPPAVRAFVESSVGLCEPDRVHICDGSEGENQQLLGHM
EAEGMIKRLRKLDNCWLALTDPGDVARIESKTVIITQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFKARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVTSMRIMTRMGTAV
LEALGDGEFVKCLHSVGCPLPLKKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEQGWLAEHMLILGITNPKGQKKYFAAAFPSACGKTNLAMMNPSL
PGWKIECVGDDIAWMKFDQQGNLRAINPENGFFGVAPGTSVKTNPNAIETIQKNTIFTNV
AETSDGGIYWEGIDQPLAPGIRITSWKNKEWTPQDGEPCAHPNSRFCTPASQCPIIDPAW
ESPEGVPIEGIIFGGRRPTGVPLVYEALSWQHGVFVGAAMRSEATAAAEHRGKVIMHDPF
AMRPFFGYNFGKYLAHWLSMAQRPAARLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWM
FNRIAGEAGAKLTPIGYVPEEGGLNLTGLGDINTKELFHISKEFWEKEAEDIQKYLEEQV
NADLPHEVQREVLALKQRISQM
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgcctcctcagctccaaaacggcctcagcttctcagccaaagtcatccagggcaccctc
gacagcctgcccccggcggtgagagccttcgtggagagcagcgtcgggctgtgcgagcct
gaccgcgtccacatctgcgatggctccgagggggagaaccagcagctgctgggccacatg
gaagcagagggcatgatcaagaggctgcggaagctggacaactgctggttggctctcact
gaccccggggatgtggccagaattgaaagcaagacagtcatcattacgcaagagcaaaga
gataccgtgcccatccccaaaactggcctcagccaactaggtcgctggatgtcggaggag
gactttgagaaagcgttcaaagcccggtttccggggtgcatgaaaggtcgcaccatgtac
gtcatcccgttcagcatggggcccctgggctcacctctgtcgaagatcggcatcgagctg
acagattcgccctacgtggtgaccagcatgcgtatcatgacgcggatgggtactgccgtc
ctggaagcgctgggggacggggaattcgtcaagtgcctccattctgtgggatgccctttg
cctttaaaaaagcctttggtgaacaactggccgtgtaacccggagctgacactcatcgcg
cacctgcctgaccgcagggaaatcatctccttcgggagtgggtacggcgggaactcactc
cttgggaagaaatgctttgctctcaggatggccagccggctggcgaaggaacagggttgg
ctggcagagcacatgctgatcctgggcataaccaaccccaagggccagaagaagtacttt
gcagcagcctttcccagcgcctgcgggaagaccaacctggccatgatgaaccccagcctc
cccgggtggaagatagagtgtgtgggtgatgacatcgcctggatgaaatttgaccaacaa
ggtaacttaagggctatcaacccagaaaatggcttttttggtgtggctcctggaacgtct
gtgaagaccaaccccaacgccatcgagaccatccagaagaacaccatattcaccaatgtg
gccgagaccagcgatgggggcatttactgggagggcatcgaccagccgctggccccgggc
atcaggatcacttcgtggaagaacaaggagtggaccccccaggacggggaaccttgtgcc
catcccaactcacgcttctgcacccctgccagccagtgccctatcatcgaccctgcctgg
gaatctccggaaggggtgcccattgagggcatcatcttcgggggccgccgacctactggt
gtccccctggtctatgaagctctcagttggcagcacggagtttttgtgggggcggctatg
cgatcagaggccacagcggctgcagaacaccgaggcaaggtcatcatgcacgaccccttt
gccatgcggcccttcttcggctacaacttcggcaaatacctggcccactggctcagcatg
gcccagcgcccagcagccaggctgcccaagatcttccatgtcaactggttccggaaagac
aaggaaggcaaattcctctggccgggctttggcgagaactccagggtgctggagtggatg
ttcaaccgcatcgccggggaagccggcgccaagctcacgcccatcggctacgtccccgag
gaggggggtctgaatctgacaggcctgggggacatcaacacgaaggagctcttccacatc
tccaaggagttctgggagaaggaggcagaagacatccaaaagtacctagaggagcaggtt
aacgccgacctcccccacgaagtccagagagaggtccttgccctgaagcagagaatcagc
cagatgtaa

DBGET integrated database retrieval system