KEGG   Ursus arctos horribilis: 113246193
Entry
113246193         CDS       T05909                                 

Gene name
RORC
Definition
(RefSeq) nuclear receptor ROR-gamma isoform X1
  KO
K08534  RAR-related orphan receptor gamma
Organism
uah  Ursus arctos horribilis
Pathway
uah04659  Th17 cell differentiation
uah04710  Circadian rhythm
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113246193 (RORC)
  09159 Environmental adaptation
   04710 Circadian rhythm
    113246193 (RORC)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113246193 (RORC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113246193 (RORC)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:uah03310]
    113246193 (RORC)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    113246193 (RORC)
Nuclear receptors [BR:uah03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   113246193 (RORC)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 113246193
NCBI-ProteinID: XP_026342483
UniProt: A0A3Q7V0A5
LinkDB
Position
Unknown
AA seq 518 aa
MDRAPQRQHRASQELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
CHVVYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQRQQQQQRGQVAKTPPAGGQGADPLACPVGLPDGQLPLGSSPDLPEAAACPPGLLRAP
GSGSSYLSSLAKAGPDGASYHLEYSPERGKAEASEGFYSTGSQLSRDRCGLRFEDAGHPG
LEEPGRGPDGYCSPSFHSATEASYASLTETEHLVQNVCKSYRETCQLRLEDLLRQRPNIF
SREEVAGYQRKSMWEMWERCAHRLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV
VLVRMCRAYNADNHTVFFEGKYGGMELFRALGCSELISSIFDFSRSLSSLHFSEDEIALY
TALVLINANRPGLQEKRKVEQLQHNLELAFHHHLYKTHRQGILAKLPPKGKLRSLCSQHV
EKLQTFQHLHPIVVQAAFPPLYKELFSTETESPEGLSE
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggacagggccccacagagacagcaccgagcctcgcaggagctgctggctgcaaagaag
acccacacctcacaaattgaagtgattccttgcaaaatctgtggggacaagtcatctggg
atccactacggggttatcacctgtgaggggtgcaagggtttctttcgccggagccagcag
tgtcacgtggtctactcctgcacccgccagcagaactgccccatcgaccgtaccagccgg
aaccggtgccagcactgtcgcctgcagaaatgcctggccctgggcatgtcccgagacgct
gtcaagttcggccgcatgtccaagaagcagagggacagcctgcatgccgaggtgcagaaa
cagctgcagcggcagcaacagcagcagcggggacaggtggccaagaccccgccagcgggg
ggccagggagccgacccccttgcctgccccgtagggctcccggatgggcagcttcccctg
ggctcctcacccgacctgcctgaggccgcggcctgcccccctggcctcctgagagcccca
ggctccgggtcctcctacctgagcagcttggccaaggccgggcctgacggggcctcatac
cacctggaatacagccccgagaggggcaaggctgaggccagtgagggtttctacagcaca
ggcagccagctgagccgtgacagatgtggacttcgttttgaggatgccgggcatcctggg
ctcgaggaaccaggacggggcccggacggctactgcagccccagtttccacagtgccacg
gaggcgtcctatgcctccctgacggagactgagcacctggtgcagaacgtttgtaagtcc
taccgagagacgtgtcagctgcggctggaggacctgctccggcagcgccctaacatcttc
tcccgggaggaggtggccggctaccagaggaagtccatgtgggagatgtgggaacgctgc
gcccaccgcctcaccgaggccattcagtacgtggtggagttcgctaagaggctctcaggc
tttatggagctctgccagaatgaccagattgtgcttctcaaagcaggagcaatggaagta
gtgctggtgaggatgtgccgggcctacaacgctgacaaccacacggtgtttttcgaaggc
aaatacggtggcatggagctgtttcgagccttgggctgcagtgagctcatcagttctatc
ttcgacttctcccgctccctgagctccttgcacttttccgaggacgagattgctctctac
acagcccttgtgctcatcaatgctaaccggccagggctccaagagaagaggaaagtcgag
cagctgcagcacaacctggagctggcttttcatcaccatctctacaagactcaccgccaa
ggcatcctggcaaagctgccgcccaaggggaagcttcggagcctgtgtagccagcatgtg
gaaaagctgcaaaccttccagcatctccaccccatcgtggtccaagctgctttccctcca
ctctacaaggaactcttcagcactgaaactgagtcacccgaagggctgtctgagtga

DBGET integrated database retrieval system