KEGG   Ursus arctos horribilis: 113246198
Entry
113246198         CDS       T05909                                 

Gene name
MCL1
Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
uah  Ursus arctos horribilis
Pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04630  Jak-STAT signaling pathway
uah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113246198 (MCL1)
   04151 PI3K-Akt signaling pathway
    113246198 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113246198 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    113246198 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 113246198
NCBI-ProteinID: XP_026342495
UniProt: A0A3Q7UQU4
LinkDB
Position
Unknown
AA seq 350 aa
MFGLKRNAVIGLNLYCGGAGLGAGSGGAASSGGRLLASGKEATARREVGGGEAGAVIGGS
AGASPPATLAPDARRVARPSPIGAEGPDVTATPPRLLFLEPTRRASPPEEMEGPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtttggcctgaagagaaacgcagtaatcggactcaacctctactgtgggggggccggg
ttgggggccggcagcggcggcgcagcctcatcgggagggcggcttttggcttcggggaag
gaggccacggcccggcgggaggtagggggaggggaagccggtgcggtgattggcggaagc
gccggcgctagtcccccggccactctcgcgccggacgcccggagggtcgcgcggccctcg
cccattggcgccgagggtcccgacgtcacggcgacccccccgaggctactgttcctcgag
cccacccgccgcgcgtcgccgcctgaagagatggaaggcccagccgccgacgccatcatg
tcgcccgaagaggagctggacgggtacgagccggaacctttggggaagcggccggctgtc
ctgcctttgctggagttggtcggggaggccagcggtggcccttgtacggacggctcactg
ccctcgacgccacccccagcagaggaggaggaagacgagttgtaccggcagtcgctggag
attatctctcggtaccttcgggagcaggcaacaggcgccaaggacgcgaaaccgctgggc
gggtctggggcggccagccggaaggcgttagagaccctccgacgggtcggggacggggta
cagcgcaaccacgagacggccttccaaggcatgcttcggaaactggacatcaaaaacgaa
gacgatgtcaaatctttgtctcgagtgatggtccatgttttcagtgacggagtaacaaac
tggggcaggattgtgactcttatttcttttggtgcctttgtggccaaacacttgaagagt
ataaaccaagaaagctgcatcgaaccattagcagaaagcatcacagatgttctcgtaagg
acaaaacgagactggctagtcaaacaaagaggctgggatgggtttgtggagttcttccat
gtagaggacctagaaggtggcatcagaaatgtgctgctggcttttgcaggtgttgctgga
gtaggagctggtttggcatatctaataagatag

DBGET integrated database retrieval system