KEGG   Ursus arctos horribilis: 113246400
Entry
113246400         CDS       T05909                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113246400 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113246400 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113246400 (CNTF)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113246400 (CNTF)
SSDB
Motif
Pfam: CNTF
Other DBs
NCBI-GeneID: 113246400
NCBI-ProteinID: XP_026342794
UniProt: A0A3Q7VIT0
LinkDB
Position
Unknown
AA seq 200 aa
MAFAEHSTLTPHRRDLCSRSIWLARKIRSDLTALLESYMKHQGLNENINLDSVDGVPVAS
TDRWSELTEAERLQENLQAYRAFHVMLARLLEDQQVHFTPAEGDFHQAIHTLLLQVAAFA
YQLEELMMLLEHKIPPNEADGMPIIGGDGGLFEKKLWGLKVLRELSQWTVRSIHDLRVIS
SHQTGIPAHGSHYIANDKKI
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcttttgcagagcactcaacgctgacccctcaccgccgggacctctgtagccgctct
atctggctagcgaggaagattcgttcagacctgactgctcttttggaatcttatatgaag
catcagggcctgaacgagaacataaacctggactctgtggatggtgtgccagtggcaagc
acggatcggtggagtgagctgactgaggcagagcgactccaagagaacctccaagcttat
cgtgccttccatgttatgttggccaggcttttagaagaccaacaggtgcattttactcca
gctgaaggggatttccatcaagcaatacatacccttctactccaggttgctgcctttgct
taccagctggaggaattaatgatgcttctggaacacaagatcccccccaacgaggctgat
gggatgcccatcattggtggagatggtggtctcttcgagaagaagctgtggggcctaaag
gtgttgcgagaactttcacagtggacagtgaggtccatccatgaccttcgagtcatttct
tctcatcagactgggattccagcacatggaagccattatattgctaatgacaagaaaata
tag

KEGG   Ursus arctos horribilis: 113254294
Entry
113254294         CDS       T05909                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin isoform X1
  KO
K06854  thrombopoietin
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113254294 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113254294 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113254294 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113254294 (THPO)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113254294 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 113254294
NCBI-ProteinID: XP_026353264
UniProt: A0A3Q7WG45
LinkDB
Position
Unknown
AA seq 324 aa
MELTELLLVVMLLTARLDLCLPAPPACDPRLLNKLLRDSHVLHSRLSQCPDVNPLFTPVL
LPAVDFSLGEWKTQKEQTKAQDVLGAAALLLEGVMAARRQLGPTCLSSLLGQLSGQVRLL
LGALQGLLGTQLPPQGRTTTHKDPSAIFLTFQQLLRGKVRFLLLVVGPTLCAKQALPTTA
VPSDTSLLLTLHKLPNRTFGLLETNSNVSARTTGSGLLKRLQGFRAKIPGLLNQTSRSLE
QTPGPLNRTHGPLTGTHGLFPGPSPTALGAPDIPPGASDMDSLPPDLWPGYSPSPIHPPI
GQYTLFSPSPTSPTPPGPAPTSIS
NT seq 975 nt   +upstreamnt  +downstreamnt
atggagctgactgaactgctcctcgtggtcatgcttctaactgcaagactggatctgtgc
ctcccggctcctcccgcctgcgacccccgtctcctaaataaactgcttcgtgactcccat
gtcctccacagcagactgagccagtgtccagacgttaaccctttgttcacacctgtcctg
ctgcctgctgtggactttagcttgggagaatggaaaacccagaaggagcagaccaaggca
caggacgttctgggagctgcagcccttctgctggagggagtaatggcagcccggagacaa
ctgggacccacctgcctctcatccctcctgggacagctttctggacaggtccgcctcctc
cttggggccctgcagggcctcctgggaacccagcttcctccacagggcaggacaacaact
cacaaggaccccagtgccattttcctgaccttccagcaactgctccgaggaaaggtgcgc
ttcctgctgcttgtcgtagggcccaccctctgtgccaagcaggccctccccacgacagct
gtcccaagcgatacctcgctactcctcacactgcacaagctcccaaacaggacttttgga
ttgttggagacaaactccaatgtctcagccagaactactggctccggacttctgaagagg
ctgcagggattcagagccaagattcctggtctgctgaaccaaacctccaggtccctagaa
caaacgcctggacccctgaacaggacacacggacccttgactggaacccatggactcttt
cctggaccctcacccacagccctaggagccccagacattcctccgggagcttcagacatg
gactccctgccccccgacctctggcctggatattctccttccccaatccatcctcctatt
gggcaatacacactcttctctccttcacccacctcgcccacccccccggggccagctcca
acctccatctcctga

KEGG   Ursus arctos horribilis: 113263750
Entry
113263750         CDS       T05909                                 

Gene name
LEP
Definition
(RefSeq) leptin isoform X1
  KO
K05424  leptin
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04080  Neuroactive ligand-receptor interaction
uah04152  AMPK signaling pathway
uah04630  Jak-STAT signaling pathway
uah04920  Adipocytokine signaling pathway
uah04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113263750 (LEP)
   04152 AMPK signaling pathway
    113263750 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113263750 (LEP)
   04060 Cytokine-cytokine receptor interaction
    113263750 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113263750 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113263750 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113263750 (LEP)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113263750 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 113263750
NCBI-ProteinID: XP_026366341
UniProt: A0A3Q7VZF8
LinkDB
Position
Unknown
AA seq 167 aa
MRCGPLCRFLWLWPYLSYIEAVPIRKVQDDTKTLIKTIVTRINDISHTQAVSSKQRVAGL
DFIPGLHPVLSLSRMDQTLAIYQQILTSLHSRNVVQISNDLENLRDLLHLLASSKSCPLP
RARGLESFESLGGVLEASLYSTEVVALSRLQAALQDMLRRLDLSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcgttgcggacccctgtgccgattcctgtggctttggccctatctgtcctatattgaa
gccgtgccgatccgaaaagtgcaggatgacaccaaaacactcatcaagacgattgtcacc
aggatcaatgacatttcacacacgcaggctgtctcctccaaacagagggtcgctggtcta
gacttcattcctgggctccacccggtcctcagtctgtccaggatggaccagacgttggcc
atctaccaacagatcctcaccagtctgcattccagaaatgtggtccaaatatctaatgac
ctggagaacctccgggaccttctccacttgctggcctcctccaagagctgccccttgccc
cgggccaggggcctggagagcttcgagagcctgggcggtgttctagaagcctcgctgtac
tccacggaggtggtggccctgagcaggctgcaggcggccctgcaggacatgctgcggcgg
ctggacctcagccctgggtgctga

KEGG   Ursus arctos horribilis: 113264523
Entry
113264523         CDS       T05909                                 

Gene name
PRL
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04080  Neuroactive ligand-receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113264523 (PRL)
   04151 PI3K-Akt signaling pathway
    113264523 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113264523 (PRL)
   04060 Cytokine-cytokine receptor interaction
    113264523 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    113264523 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113264523 (PRL)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113264523 (PRL)
SSDB
Motif
Pfam: Hormone_1 KIAA1430
Other DBs
NCBI-GeneID: 113264523
NCBI-ProteinID: XP_026367363
UniProt: A0A3Q7WZJ9
LinkDB
Position
Unknown
AA seq 229 aa
MDKKGWSLKGSLLPLLLLVSDLLLCQSVASLPICPTGAVNCQVSLRDLFDRAVILSHYIH
NLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRS
WNDPLYHLVTEVRGMQEAPDSILSRAIEIEEQNRRLLEGMEKIVGQVHPGVRENEVYSVW
SGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC
NT seq 690 nt   +upstreamnt  +downstreamnt
atggacaaaaaagggtggtcgctgaaagggtctctcctgcccctgctgctgctggtgtcg
gacctgctcctgtgccagagcgtggcctccctgcccatctgtcccaccggggctgtcaac
tgccaggtgtccctccgagacctgtttgaccgcgcggtcattctgtctcactacatccat
aacctctcctcggagatgttcaacgaatttgataaaaggtatgcccaaggccgggggttc
attaccaaggccatcaacagctgtcacacttcctccctctctacccctgaagacaaggag
caagcccagcagatccatcacgaagaccttctgaacctgatactcagagtgctacgctcg
tggaatgaccccctgtaccatctagtcacagaagtacggggtatgcaagaagccccagat
tcgattctgtccagagccatagagattgaggaacaaaacagaagacttctagagggtatg
gagaagatagttggccaggttcatcctggagtcagagaaaatgaggtctactcggtctgg
tcaggacttccatcccttcagatggccgatgaagacacacgcctttttgctttttataac
ctgctccactgcctacgcagggattcacataagattgacaattatctcaagctcctgaag
tgccgcatcgtctacgacagcaactgctaa

KEGG   Ursus arctos horribilis: 113265156
Entry
113265156         CDS       T05909                                 

Definition
(RefSeq) somatotropin
  KO
K05438  growth hormone
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04080  Neuroactive ligand-receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113265156
   04151 PI3K-Akt signaling pathway
    113265156
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113265156
   04060 Cytokine-cytokine receptor interaction
    113265156
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    113265156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113265156
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113265156
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 113265156
NCBI-ProteinID: XP_026368046
UniProt: A0A3Q7W4J7
LinkDB
Position
Unknown
AA seq 245 aa
MFSVPGGRGRAGRKQASCRLGPSLALCVPPCVDPQSSVLLAFALLCLPWPQEVGAFPAMP
LSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDE
AQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRE
LEDGSPRAGQILKPTYDKFDTSLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVE
SSCAF
NT seq 738 nt   +upstreamnt  +downstreamnt
atgttctcagtccctggggggaggggaagggctggcaggaaacaggcctcttgccgtctg
ggccccagccttgccctctgtgtccctccgtgtgtagaccctcagagctctgtgctcctg
gccttcgccctgctctgcctgccttggcctcaggaggtgggcgccttcccggccatgccc
ttgtccagcctgtttgctaacgctgtgctccgggcccagcacctgcaccagctggctgcc
gacacctacaaagagtttgagcgtgcgtacatcccggagggccagaggtattccatccag
aatgcgcaggccgccttctgcttctcggagaccatcccggcccccacgggcaaggacgag
gcccagcagagatccgacgtggagctgctgcgcttctccctgctgctcatccagtcgtgg
ctcgggcccgtgcagttcctcagcagggtcttcaccaacagcctggtgttcggcacctca
gaccgagtctacgagaagctgaaggacctggaggaaggcatccaagcgctgatgcgggag
ctagaagacggcagcccccgggctgggcagatcctgaagccaacgtatgacaagtttgac
acaagcctgcgcagcgacgacgcactgctcaagaactacgggctgctctcctgcttcaag
aaggacctgcacaaggctgagacctacctgcgggtcatgaagtgtcgtcgcttcgtggaa
agcagctgtgccttctag

KEGG   Ursus arctos horribilis: 113265687
Entry
113265687         CDS       T05909                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor
  KO
K05423  granulocyte colony-stimulating factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04657  IL-17 signaling pathway
uah05144  Malaria
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113265687 (CSF3)
   04151 PI3K-Akt signaling pathway
    113265687 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113265687 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113265687 (CSF3)
   04657 IL-17 signaling pathway
    113265687 (CSF3)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    113265687 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113265687 (CSF3)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113265687 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL6
Other DBs
NCBI-GeneID: 113265687
NCBI-ProteinID: XP_026369019
UniProt: A0A3Q7XQE4
LinkDB
Position
Unknown
AA seq 195 aa
MKLTALQLLLWQSALWLVQEASPPGPGSSLPQSFLLKCFEQMRKVQADGTALQERLCATY
KLCHPEELVLLGHALGIPQPPLSSCSSQALQLTGCLRQLHGGLFLYQGLLQALAGISPEL
APTLDTLQLDISDFAVNIWQQMEELGVAPAVPPTQGTMPTFTSSFQRRAGGVLVTSDLQS
FLELAYRALRSFAKP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctgacggccctgcagctgttgctgtggcaaagcgcactctggctagtgcaagaa
gccagccccccgggcccgggcagctccctgccccagagcttcctgctcaagtgtttcgag
caaatgaggaaggtccaggctgacggcacagcgctgcaggagaggctgtgtgccacctac
aagctgtgccaccccgaggagctggtgctgctgggacacgctctgggcatcccccagcct
ccgctgagcagctgctccagccaggccctgcagctgacgggctgcctgcgccaactccac
ggcggcctcttcctgtaccagggcctcctgcaggctctggcggggatatcccccgagctg
gcccccaccttggacacgctgcagctggacatcagcgactttgccgtcaacatctggcag
cagatggaagagctgggggtggccccggcagtgccgcccacccagggaaccatgccaacc
ttcacctcgtccttccagcgccgggcgggaggggtcctggtgacctccgacctgcagagc
ttcctggagctggcctaccgcgctctgcgctcctttgccaaaccctga

KEGG   Ursus arctos horribilis: 113267523
Entry
113267523         CDS       T05909                                 

Gene name
EPO
Definition
(RefSeq) LOW QUALITY PROTEIN: erythropoietin
  KO
K05437  erythropoietin
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04066  HIF-1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113267523 (EPO)
   04066 HIF-1 signaling pathway
    113267523 (EPO)
   04151 PI3K-Akt signaling pathway
    113267523 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113267523 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113267523 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113267523 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113267523 (EPO)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113267523 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 113267523
NCBI-ProteinID: XP_026371318
UniProt: A0A3Q7XAB8
LinkDB
Position
Unknown
AA seq 277 aa
MNRLGKYSLNLDAYDWDLGGKRNRALKAKQGWEAAWVLRGKLGPEARQDVRTGSQYARTE
EGLQSRLERSGTCEPAPPXPTHSVWHSFLECPALLLLLSLLLLPLGLPVLGAPPRLICDS
RVLERYILEAREAENVTMGCAQGCSFSENITVPDTKVNFYTWKRMDVGQQAVEVWQGLAL
LSEAILRGQALLANSSQLSETLRLHVDKAISSLRSLTSLLRALGAQKEAISLPEEASAAP
LRTFTVDTLCKLFRIYSNFLRGKLTLYTGEACRRGDR
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaccgtttgggaaaatactcgctaaatctggatgcttacgactgggatctgggaggg
aagcggaaccgggctctgaaggccaagcagggctgggaagctgcctgggtgctgagaggg
aaactgggaccagaggcacggcaggatgtgcggactgggagtcagtatgccaggactgag
gagggactccagagcaggctggagaggagcggaacgtgtgaaccggcccctccanaaccc
acacactcagtctggcactcttttctagaatgtcctgccctgctgcttctgctgtccttg
ctgctgcttcctctgggcctcccagtcctgggcgccccccctcgcctcatttgtgacagc
cgagtcctggagaggtacatcctggaggccagggaggccgaaaatgtcacgatgggctgt
gctcaaggctgcagcttcagcgagaatatcaccgtcccagacaccaaggttaatttctac
acctggaagaggatggacgtcgggcagcaggccgtggaagtctggcagggcctggccctg
ctctcagaagccatcctgcggggccaggccctgttggccaactcctcgcagctgtctgag
accctgcggttgcacgtggacaaagccatcagcagcctgcgcagcctcacctccctgctt
cgggcgctgggagcccagaaggaggccatctcccttccagaggaagcctctgctgctcca
ctccgaacattcactgttgatactttgtgcaaacttttccgaatctactccaatttcctg
cggggaaagctgacgctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system