KEGG   Ursus arctos horribilis: 113246717
Entry
113246717         CDS       T05909                                 

Definition
(RefSeq) tyrosine-protein kinase ZAP-70
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
uah  Ursus arctos horribilis
Pathway
uah04014  Ras signaling pathway
uah04064  NF-kappa B signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah05135  Yersinia infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113246717
   04064 NF-kappa B signaling pathway
    113246717
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113246717
   04660 T cell receptor signaling pathway
    113246717
   04658 Th1 and Th2 cell differentiation
    113246717
   04659 Th17 cell differentiation
    113246717
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113246717
  09163 Immune disease
   05340 Primary immunodeficiency
    113246717
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113246717
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113246717
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     113246717
Protein kinases [BR:uah01001]
 Non-receptor tyrosine kinases
  SYK family
   113246717
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 RIO1 Haspin_kinase Kdo
Other DBs
NCBI-GeneID: 113246717
NCBI-ProteinID: XP_026343177
UniProt: A0A3Q7VZ73
LinkDB
Position
Unknown
AA seq 616 aa
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
SQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKDACPNSSASSEAAAPTLPAHPSTFTHAPRRIDTNSDGYTPEPARLVSPE
KAQSMPMDTSVYESPYSDPEELKDKKLFLKRENLLMADIELGCGNFGSVRQGVYRMRKKQ
IDVAIKVLKHSTEKTDKDEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLH
KFLLSKKEEIPISNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLS
KALGADDSYYTARSAGKWPLKWYAPECFNFRKFSSRSDVWSYGVTMWEAFSYGQKPYKKM
KGPEVIAFIEQGKRMECPPECPPEMYALMSDCWIYKWDDRPDFQAVEQRMRTYYYSVASK
AEGPPGCGKGNEAAVV
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgccggaccccgcggcgcacctgccgttcttctacggcagcatctcgcgcgccgaggcc
gaggagcacctgaagctggcgggcatggccgacgggctcttcctgctgcgccagtgcctg
cgctcgctgggcggctatgtgctctcgctcgtgcacgatgtgcgcttccaccacttcccc
atcgagcgccagctcaacggcacttacgccatcgccggcggtaaggcgcactgcggcccc
gcagagctctgcgagttctattcgcgcgaccccgacgggctgccctgcaacctgcgcaag
ccatgcaaccggccgtcgggactcgagccgcagcccggggtcttcgactgcctgcgcgac
gccatggtgcgcgactacgtgcgccagacgtggaagctggagggcgaagccctggagcag
gccatcatcagccaggctccccaggtggagaagctcatcgccacgacagctcacgagagg
atgccctggtaccacagcagcctgacgcgcgaggaggcagagcgcaaactctattctggc
tcgcagactgacggcaagttcctgttgaggccccggaaggagcagggcacttacgcactg
tcgctgatctatgggaaaaccgtgtaccactacctcatcagccaggacaaggcgggcaag
tactgtattcctgagggcaccaagtttgacacgctctggcagctggtggagtacctgaaa
ctgaaggccgatgggctcatctactgcctgaaggatgcctgccccaacagcagtgccagc
tcagaggccgctgctcccacactcccagcccatccatccacgttcacccacgctcccaga
cggattgacaccaactcagatgggtacacccctgaaccagcacgcctagtgtccccagag
aaagcgcagtcaatgcccatggacacgagtgtgtacgagagcccatacagtgaccctgag
gagctcaaggacaagaagctcttcctgaagcgggagaacctcctcatggctgacattgaa
cttggctgtggcaactttggctctgtacgccagggcgtctaccgcatgcgcaagaagcag
attgacgtggccatcaaggtgttgaagcacagcacggagaagacagacaaggatgagatg
atgcgcgaggcacagatcatgcaccagctggacaacccctacatcgtgcggctcatcggc
gtctgccaggccgaggccctcatgcttgtcatggagatggcgggcggcgggcccctgcac
aagttcctgctcagcaagaaggaggagatccccatcagcaatgtggcggagctgctgcac
caggtgtccatggggatgaagtacctggaggagaaaaactttgtgcaccgtgacctggcg
gcccgcaatgtcttgctggtcaaccggcactatgccaagatcagtgactttggtctctcc
aaggcactgggtgccgacgacagctactacactgcccgctcggcagggaagtggccgctc
aagtggtatgcacccgagtgcttcaacttccgcaagttctccagccgcagtgacgtctgg
agctatggggtcaccatgtgggaggccttctcctatggccagaagccctacaagaagatg
aaaggccccgaggtcatagccttcatcgagcagggcaagcggatggagtgcccgccagag
tgtccgcctgaaatgtatgcactcatgagtgactgctggatctacaagtgggacgaccgc
ccagacttccaggccgtggaacagcgcatgcggacctactattacagcgtggcaagcaag
gctgaaggccccccagggtgtggcaaggggaatgaggctgctgttgtctga

DBGET integrated database retrieval system