KEGG   Ursus arctos horribilis: 113247197Help
Entry
113247197         CDS       T05909                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04020  Calcium signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04114  Oocyte meiosis
uah04140  Autophagy - animal
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04261  Adrenergic signaling in cardiomyocytes
uah04270  Vascular smooth muscle contraction
uah04310  Wnt signaling pathway
uah04340  Hedgehog signaling pathway
uah04371  Apelin signaling pathway
uah04530  Tight junction
uah04540  Gap junction
uah04611  Platelet activation
uah04713  Circadian entrainment
uah04714  Thermogenesis
uah04720  Long-term potentiation
uah04723  Retrograde endocannabinoid signaling
uah04724  Glutamatergic synapse
uah04725  Cholinergic synapse
uah04726  Serotonergic synapse
uah04727  GABAergic synapse
uah04728  Dopaminergic synapse
uah04740  Olfactory transduction
uah04742  Taste transduction
uah04750  Inflammatory mediator regulation of TRP channels
uah04910  Insulin signaling pathway
uah04911  Insulin secretion
uah04912  GnRH signaling pathway
uah04913  Ovarian steroidogenesis
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04916  Melanogenesis
uah04918  Thyroid hormone synthesis
uah04919  Thyroid hormone signaling pathway
uah04921  Oxytocin signaling pathway
uah04922  Glucagon signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04924  Renin secretion
uah04925  Aldosterone synthesis and secretion
uah04926  Relaxin signaling pathway
uah04927  Cortisol synthesis and secretion
uah04928  Parathyroid hormone synthesis, secretion and action
uah04934  Cushing syndrome
uah04935  Growth hormone synthesis, secretion and action
uah04961  Endocrine and other factor-regulated calcium reabsorption
uah04962  Vasopressin-regulated water reabsorption
uah04970  Salivary secretion
uah04971  Gastric acid secretion
uah04976  Bile secretion
uah05012  Parkinson disease
uah05020  Prion diseases
uah05030  Cocaine addiction
uah05031  Amphetamine addiction
uah05032  Morphine addiction
uah05034  Alcoholism
uah05146  Amoebiasis
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113247197 (PRKACA)
   04010 MAPK signaling pathway
    113247197 (PRKACA)
   04310 Wnt signaling pathway
    113247197 (PRKACA)
   04340 Hedgehog signaling pathway
    113247197 (PRKACA)
   04371 Apelin signaling pathway
    113247197 (PRKACA)
   04020 Calcium signaling pathway
    113247197 (PRKACA)
   04024 cAMP signaling pathway
    113247197 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113247197 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    113247197 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    113247197 (PRKACA)
   04540 Gap junction
    113247197 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113247197 (PRKACA)
   04062 Chemokine signaling pathway
    113247197 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    113247197 (PRKACA)
   04910 Insulin signaling pathway
    113247197 (PRKACA)
   04922 Glucagon signaling pathway
    113247197 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    113247197 (PRKACA)
   04912 GnRH signaling pathway
    113247197 (PRKACA)
   04913 Ovarian steroidogenesis
    113247197 (PRKACA)
   04915 Estrogen signaling pathway
    113247197 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    113247197 (PRKACA)
   04921 Oxytocin signaling pathway
    113247197 (PRKACA)
   04926 Relaxin signaling pathway
    113247197 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    113247197 (PRKACA)
   04918 Thyroid hormone synthesis
    113247197 (PRKACA)
   04919 Thyroid hormone signaling pathway
    113247197 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    113247197 (PRKACA)
   04916 Melanogenesis
    113247197 (PRKACA)
   04924 Renin secretion
    113247197 (PRKACA)
   04925 Aldosterone synthesis and secretion
    113247197 (PRKACA)
   04927 Cortisol synthesis and secretion
    113247197 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113247197 (PRKACA)
   04270 Vascular smooth muscle contraction
    113247197 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    113247197 (PRKACA)
   04971 Gastric acid secretion
    113247197 (PRKACA)
   04976 Bile secretion
    113247197 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    113247197 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    113247197 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    113247197 (PRKACA)
   04727 GABAergic synapse
    113247197 (PRKACA)
   04725 Cholinergic synapse
    113247197 (PRKACA)
   04728 Dopaminergic synapse
    113247197 (PRKACA)
   04726 Serotonergic synapse
    113247197 (PRKACA)
   04720 Long-term potentiation
    113247197 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    113247197 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    113247197 (PRKACA)
   04742 Taste transduction
    113247197 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    113247197 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    113247197 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    113247197 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    113247197 (PRKACA)
   04714 Thermogenesis
    113247197 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113247197 (PRKACA)
   05205 Proteoglycans in cancer
    113247197 (PRKACA)
   05203 Viral carcinogenesis
    113247197 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    113247197 (PRKACA)
   05020 Prion diseases
    113247197 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    113247197 (PRKACA)
   05031 Amphetamine addiction
    113247197 (PRKACA)
   05032 Morphine addiction
    113247197 (PRKACA)
   05034 Alcoholism
    113247197 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    113247197 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113247197 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113247197 (PRKACA)
   05163 Human cytomegalovirus infection
    113247197 (PRKACA)
   05165 Human papillomavirus infection
    113247197 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113247197 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113247197 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113247197 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:uah03019]
    113247197 (PRKACA)
   03036 Chromosome and associated proteins [BR:uah03036]
    113247197 (PRKACA)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     113247197 (PRKACA)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: AGC group
  PKA family
   113247197 (PRKACA)
Messenger RNA biogenesis [BR:uah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     113247197 (PRKACA)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    113247197 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 113247197
NCBI-ProteinID: XP_026343903
UniProt: A0A3Q7V4H7
LinkDB All DBs
Position
Unknown
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMI
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgcagccgccaagaagggcagcgagcaggagagcgtgaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaatacagcccat
ttggatcagtttgaacgaatcaagaccctcggcacgggctcctttgggcgggtgatgctg
gtgaagcacaaggagaccgggaaccactttgccatgaagatcctcgacaaacagaaggtg
gtgaagctgaaacagatcgagcataccctgaacgaaaagcgcatcctgcaagcggtcaac
tttccgttcctcgtcaaactcgagttctccttcaaggacaactcgaatttatacatgatc
atggagtacgtgcccggcggggagatgttctcgcacctgcggcggatcggaaggttcagt
gagccacatgcccgcttctatgcggcccagatcgtcctgaccttcgagtacctgcactca
cttgacctcatctaccgggacctgaagccggagaacctcctcattgaccagcagggctac
attcaggtgacagacttcggttttgccaagcgtgtaaaaggccgcacctggaccttatgc
gggacccctgagtacctggccccggagatcattctgagcaaaggctacaacaaggctgtg
gactggtgggccctgggagttctcatctacgagatggctgctggctacccgcccttcttc
gctgaccagcccatccagatctatgagaagattgtctctgggaaggtgcggttcccatcc
cacttcagctccgacctgaaggatctgctgcggaacctgctgcaggtggacctcaccaaa
cgcttcgggaacctcaagaacggagtcaatgatatcaagaaccacaagtggtttgccaca
actgactggatcgccatctaccagaggaaggtggaagctcccttcataccaaagttcaaa
ggccctggggacacgagtaattttgacgactatgaggaggaagagatccgagtctccatc
aatgagaagtgtggcaaggagtttactgagttttag

DBGET integrated database retrieval system