KEGG   Ursus arctos horribilis: 113247412
Entry
113247412         CDS       T05909                                 

Gene name
IL18R1
Definition
(RefSeq) interleukin-18 receptor 1 isoform X1
  KO
K05173  interleukin 18 receptor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04668  TNF signaling pathway
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    113247412 (IL18R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113247412 (IL18R1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113247412 (IL18R1)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113247412 (IL18R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113247412 (IL18R1)
   04090 CD molecules [BR:uah04090]
    113247412 (IL18R1)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL1 receptor family
   113247412 (IL18R1)
CD molecules [BR:uah04090]
 Proteins
  113247412 (IL18R1)
SSDB
Motif
Pfam: TIR Ig_2 V-set TIR_2 Ig_3 I-set Ig_6 Antig_Caf1 Ig_5
Other DBs
NCBI-GeneID: 113247412
NCBI-ProteinID: XP_026344278
UniProt: A0A3Q7UXV8
LinkDB
Position
Unknown
AA seq 539 aa
MRHTELLLTILVLMFTRTSETCTSRFNITAVRGEPFYLRYCSSGSERKDETVAIRWYKGS
GPHARTELRSSSSPRISLRDYVLEFWPVELEDSGSYFFQMGNDTHEWKLNVIGKSKHSCF
AEKQLISKTVEVQKSLHINCKHPYYEELAHRISLYKNCEKMENNKNPVLQKNAEFEDQGY
YTCVFFVPYNGNLFNVTKTFNVTVVGDRSKIIPVLLGPKVNHVKVELGKDVELNCSALAN
EKDAVYWNVWEENGKEPNVHEENITRTRTPDGKLYASRILRIENINEKNLNFSYNCAVAS
EGGTDTISFVLVKKEDMVDIPGYVFTRGMIVAVLISVVVVCLVVIGVIYRVDLALFYRHF
MRKDETLTDGKTYDAFVSYLKECGPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVVPG
GAIVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVSDF
TFFPQSLQLLKSHRVLKWNADKPPSYNSRFWKNLLYLMPAKMVKPCGAESEVLPVLSRS
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgcgtcatacagagctactcttgacaattttggtgcttatgtttacaaggacctccgaa
acttgtacttcacgttttaacatcactgcagtcagaggggaacctttctatctgagatat
tgctcatcaggatctgagcgcaaggatgaaacagtcgccatcagatggtacaagggcagc
ggaccacacgcgcgcactgagctccgctcaagtagctcacccagaatttctctgcgcgat
tacgttctggagttttggccagttgagttggaggacagtggctcttactttttccaaatg
ggaaatgatacacatgaatggaaattaaatgtcattggaaaaagtaaacacagctgtttt
gctgaaaaacaactaattagtaaaactgtggaagttcaaaaatctttgcatataaactgt
aaacacccatactatgaagaactggcccatagaatatcactgtacaagaactgtgaaaag
atggagaacaataaaaacccagttttacagaagaatgcagagtttgaagatcagggatat
tacacctgtgtgttttttgttccttataatggaaacctatttaatgtcaccaaaaccttc
aatgtaacagtagttggagatcgcagcaaaataattcctgttcttcttggaccaaaggtt
aaccacgtgaaggtggaattagggaaagatgtagaactcaactgctctgctttggcgaat
gaaaaggatgcagtttattggaatgtgtgggaagaaaatggaaaggaacccaatgtacat
gaagagaacataacaagaactaggactccagatggcaaattgtatgcatcaagaatattg
agaattgagaatattaatgaaaaaaatctgaacttttcatacaattgcgctgtggccagc
gagggaggcacagacaccataagctttgtcttggtgaaaaaagaagatatggtcgatatc
ccaggctacgtcttcaccagaggaatgatcgtagctgttctgatctcagtggtagttgtg
tgcctcgtggttataggtgtcatttatagagttgacttggccctattttatagacatttc
atgagaaaagatgaaacattaacagatgggaaaacatacgatgctttcgtgtcttaccta
aaagaatgtggacccgagaatggagaagagcacacctttgctgtggagattttgcccagg
gtgttggagaaacactttgggtataaattatgcatatttgaaagggatgtagtccctgga
ggagctattgttgatgaaatccactcactgatagaaaaaagtcgaagactgatcattgtt
ctaagtaaaagctacatgtctaatgaagtcaggtatgaacttgaaagtggactccatgaa
gcactggtagaaaggaaaattaaaatcatcttaattgaatttacacctgtcagtgacttc
acattctttccccaatcactacagcttttgaaatctcacagagttctgaagtggaatgct
gataaacctccatcgtataactcaaggttctggaaaaatcttctttatctgatgcctgca
aaaatggtcaagccatgcggggctgaatctgaggtcttgcctgttctttcacggtcctga

KEGG   Ursus arctos horribilis: 113247431
Entry
113247431         CDS       T05909                                 

Gene name
IL18RAP
Definition
(RefSeq) interleukin-18 receptor accessory protein isoform X1
  KO
K05174  interleukin 18 receptor accessory protein
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113247431 (IL18RAP)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113247431 (IL18RAP)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113247431 (IL18RAP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113247431 (IL18RAP)
   04090 CD molecules [BR:uah04090]
    113247431 (IL18RAP)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL1 receptor family
   113247431 (IL18RAP)
CD molecules [BR:uah04090]
 Proteins
  113247431 (IL18RAP)
SSDB
Motif
Pfam: TIR Ig_6 Ig_2 ig Ig_3 I-set TIR_2 Ig_4 Ig_5 V-set zf-RRN7
Other DBs
NCBI-GeneID: 113247431
NCBI-ProteinID: XP_026344315
UniProt: A0A3Q7UXY1
LinkDB
Position
Unknown
AA seq 574 aa
MMLYLGWIFLWLVTGERIKEMTLSDCITKKLLWEYSSMREQFVLFCNLTQSQQSHGSPGS
ENLHCSGHKDLSDVQWYLQPQNGDPLREITNSSAHVIQKSTLHFLMTGIHDAGSYICRPR
IRSPLDEACCVKTILEVKPKTNLSCMPNNSVPHEQYLLLGSTDYIHCPTFNCQSDAQSRQ
VTWYQNGNPLLKERSNSILVDEVYEEQDGTYVCDYTESDSPSSWTVRAVVQVTTIVKDTN
HKPDILDPIKDTLEVELGKPLTLNCTARFGYQKNFTPVIKWYIKDSDREWEFPTSQEIGV
KSTKKDKVISRVIRLKKVTQRELHRKFICFAQNAIGNTTQSIQLKEKKGAVFIYILLGTV
MTLAGVLTAAALLYMYWIEIVLLYRTYQSKDETLGDRKVFDAFVSYAKWSSSESEASSSL
SEEYLALNLFPEVLENKYGYNLCLLERDVAPGGVYAEDIVNMIKKSRRGIFILSPNYVNG
PSIFELQAAVNLALDDQRLKLILIKFCSFQEPESLPHIVKRALRVLPTVTWRNSKSVPPN
SRFWKQMRYHMPVKNSKGFRQSQLRRIPEVFHLK
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgatgctttatttgggctggatatttctttggcttgtcacaggagagagaattaaagaa
atgactctttcagattgcatcaccaagaaactgctttgggaatattcttcaatgagggag
cagtttgtcttattttgtaacttaacacagtcacagcaatcccacggaagtccaggctct
gaaaacttgcactgcagtggtcataaggacctatctgatgtccagtggtacctacaacct
caaaatggagatccgttacgggaaataactaacagctctgctcacgtcatccagaagagc
accctgcactttttgatgacaggaatacatgatgctgggtcatatatctgtagacccagg
attaggagccctctggatgaggcctgttgtgtcaagaccatcttagaagtgaagcctaag
acaaatctatcctgtatgccaaataactctgtaccacacgagcaataccttcttcttggt
agcactgactatattcattgccctactttcaactgccaaagtgatgcacaaagtcgacag
gtgacctggtaccagaatggaaatccactccttaaagaaaggagcaactcaatcctagtg
gatgaagtttacgaagaacaggacggcacgtacgtgtgtgattacactgaatcggatagc
ccaagttcatggacagtcagagctgttgtccaagtgacaaccattgtgaaagacactaat
cacaaaccagatatcctggatcccatcaaggacacgctggaagtagaacttggaaagcct
ttaactcttaactgcacggcacgatttggctaccaaaagaactttacgcctgtcataaaa
tggtacattaaagattctgaccgggagtgggaattcccaacgtctcaggagattggtgtt
aaatccactaaaaaggataaagtcatttcacgtgttatccgcttgaaaaaagttactcag
agggagcttcacaggaagtttatttgctttgcccagaacgccatcggaaacactacccag
tccatccaactgaaagaaaagaaaggagcggtgttcatttacatcctacttggcaccgtc
atgaccctggcaggcgtgctgacggcagctgctctgctctacatgtactggattgaaata
gtcctgctgtaccgaacctaccagagcaaggatgagacactcggggatagaaaggtattt
gatgctttcgtatcctatgcgaaatggagctcttctgagagcgaggccagttcatctctg
agtgaggaatacctggctctgaatctgttccctgaagttttggaaaacaaatacggatac
aacttgtgtttgctcgaaagagatgtggccccgggcggagtgtatgccgaagacattgta
aacatgattaagaaaagtcgaagaggaatatttatcttgagccccaactatgtcaatgga
cccagtatctttgaactacaagccgcggtgaatctggccttggatgaccaaagactgaag
ctaattttaattaagttctgctccttccaagagccagagtctctacctcatattgtgaaa
agagctctccgggttttgcccacggtcacttggagaaactcaaaatcagtccctcccaat
tccaggttctggaagcagatgcgctaccatatgccagtgaaaaactcgaaaggattcagg
cagagccagctcagacgtatccccgaagtttttcacttgaaatga

DBGET integrated database retrieval system