KEGG   Ursus arctos horribilis: 113248349
Entry
113248349         CDS       T05909                                 

Gene name
MTCP1
Definition
(RefSeq) protein p13 MTCP-1
  KO
K16837  mature T-cell proliferation-1 type B1
Organism
uah  Ursus arctos horribilis
Pathway
uah04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113248349 (MTCP1)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 113248349
NCBI-ProteinID: XP_026345532
UniProt: A0A3Q7W5F6
LinkDB
Position
Unknown
AA seq 107 aa
MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQVQVPLGDAARPSHL
LTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcaggagaggatgtgggggctccacccgatcacctctgggttcaccaagagggtatc
taccgcgacgaataccagcgcacgtgggtggccgtcgtggaagaggagacgagtttccta
agggcacgcgtccagcaagttcaggttcccttaggtgacgcagctaggccaagtcacctt
cttacctcccagctacctctcatgtggcaactctaccctgaggaacgctacatggataac
aactctcgcttgtggcagatccagcatcatttaatggtcaggggagtacaggagctgttg
cttaagcttttgcctgatgattaa

KEGG   Ursus arctos horribilis: 113267157
Entry
113267157         CDS       T05909                                 

Gene name
TCL1A
Definition
(RefSeq) T-cell leukemia/lymphoma protein 1A
  KO
K10167  T-cell leukemia/lymphoma 1A
Organism
uah  Ursus arctos horribilis
Pathway
uah04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113267157 (TCL1A)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 113267157
NCBI-ProteinID: XP_026370908
UniProt: A0A3Q7X972
LinkDB
Position
Unknown
AA seq 115 aa
MGELPFFRAHTALHPDHLWIWERSVYVDENQRTWLPITIETESSLQVLMRQEDVSLGEAV
CPSLLAPCPLPSMWQLYPGRRYRGSDSSFWRIVYHIEFSGKEDMLLEQLPDLEDE
NT seq 348 nt   +upstreamnt  +downstreamnt
atgggcgagctcccgttcttcagggcgcacacagccttgcacccggaccacctgtggatc
tgggagaggtccgtgtacgtggacgagaaccagcgcacctggctgcccataaccatcgag
acggagagtagcctccaggtgctcatgcgtcaggaggatgtgtccctgggggaggccgtg
tgccccagcctgctagccccgtgcccattgccttccatgtggcagctctaccctggaaga
agataccgaggctcagactcgagtttctggcgcatagtgtaccacatcgagttcagcggc
aaggaggacatgctcctcgagcagctgccagacctggaggacgagtga

KEGG   Ursus arctos horribilis: 113267158
Entry
113267158         CDS       T05909                                 

Gene name
TCL1B
Definition
(RefSeq) T-cell leukemia/lymphoma protein 1B
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
uah  Ursus arctos horribilis
Pathway
uah04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113267158 (TCL1B)
SSDB
Motif
Pfam: TCL1_MTCP1 DUF1876
Other DBs
NCBI-GeneID: 113267158
NCBI-ProteinID: XP_026370910
UniProt: A0A3Q7X118
LinkDB
Position
Unknown
AA seq 126 aa
MTSGASLCLGVPLHRLWAVRPGIYEDEKGRTWVTVVVRLSPSQRARGRGSPRHEPSNTVH
MWQMPVHPREPMSPSQLPLSQLPLVWQLYPGRRYRAMDSRLWKWWTMARQITSTEQLILP
QLRPGE
NT seq 381 nt   +upstreamnt  +downstreamnt
atgacctcgggggcttctctgtgccttggggtgcccctgcaccgtctgtgggccgtgagg
cctggcatctacgaggacgagaaggggaggacctgggtgaccgtggtcgtgcgtctcagt
ccctcccagagagctcggggcaggggctccccccggcatgaacccagcaacacagtccac
atgtggcagatgccagtgcacccgcgggagcccatgtcccccagccagctgcccctctcc
cagctgcccctcgtgtggcagctctaccccggaagaaggtacagagcgatggattccagg
ctctggaagtggtggaccatggccaggcaaatcacctccacagagcagctgatcctgccg
cagctgcggcccggggagtga

DBGET integrated database retrieval system