KEGG   Ursus arctos horribilis: 113248575
Entry
113248575         CDS       T05909                                 

Definition
(RefSeq) caspase recruitment domain-containing protein 9 isoform X1
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
uah  Ursus arctos horribilis
Pathway
uah04621  NOD-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah05152  Tuberculosis
uah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113248575
   04625 C-type lectin receptor signaling pathway
    113248575
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113248575
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113248575
SSDB
Motif
Pfam: CARD CARD_2 CxC5
Other DBs
NCBI-GeneID: 113248575
NCBI-ProteinID: XP_026345896
UniProt: A0A3Q7V273
LinkDB
Position
Unknown
AA seq 536 aa
MSDYENEDQCWSALESFRVKLISVIDPSRITPYLRQCKVLNPDDEEQVLSDPSLVIRKRK
VGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPTRVFSMIIDASGESGLTQLLM
SEVLKLQRKVQDLNQLLSSKDDLIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKD
ENYDLAMRLARQSEEKGAALMRSRDLQLEIERLKHSLMRAEDDCRVERKHTLKLRHAMEQ
RPSQELVWQLQQEKTLLQARVQELEATMQDGKPDKSSPYIQVLEEDWRQALQDHQEQANT
ILSLRKDLRQGEALRARCVEEKEMFELQCLALRKDSKMYKDRIEAILQQMEEVAIERDQA
IATREGLHAQHSRSLQEKDALRKQVRELAEKADELQLQLFQREGQLLALEGRLKRQQLDA
LVLSSDLEDSSPRNSQELSLSLDLEAVQLSDKGGLANRDSPQQPSVALQEERLPLTANDA
GQGGGEPPEKERRRLKESFENYRRKRALRKMQHGSRQGEVDWENTTGSDNTDTEGS
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgtcagactatgagaacgaggaccagtgctggagtgctctagagagcttccgcgtgaag
ctcatctctgtcatcgacccctcacgcatcacaccctacctgaggcagtgcaaggtgctg
aaccccgatgatgaggagcaggtgctcagtgaccccagcctggtcatccgcaagcggaaa
gtgggcgtgctcctggacatcctgcagcggaccggccacaagggctacgtggccttcctc
gagagcctggagctctactacccgcagctctacaagaaggtcacgggcaaggagcccacc
cgtgtcttctccatgatcatcgacgcatccggggagtcaggcctgacgcagctgctgatg
agcgaggtgctgaagctgcagaggaaagtgcaggacctgaaccagctgctgagctccaag
gatgacctcatcaaggagctgcgggtgaaggacagcctgctccgcaagcaccaggagcgt
gtgcagcggctcaaggaggagtgtgaggcgggcagccgtgagctcaagcgctgcaaggat
gagaactacgacctagccatgcgcctggcccgccagagcgaggagaagggcgccgcgctc
atgcgcagccgcgacctgcagctggagatcgagcggctcaagcacagcctcatgagggcc
gaggacgactgcagggtggagcgcaagcacacgctgaagctcaggcacgccatggagcag
cggcccagccaggagctcgtgtggcagctgcagcaggagaagactttgctgcaggctcgc
gtgcaggagctggaggccaccatgcaggacgggaagccagacaagagcagcccctatatc
caagtgctggaggaggattggcgacaggcacttcaggaccaccaagagcaagccaacacc
atcctctctctgcgcaaggacctgcggcagggcgaggctctgcgcgcccggtgcgtggaa
gagaaggagatgtttgagctgcagtgcctggcgctacggaaggactccaagatgtacaag
gaccgcatcgaggccatcctgcagcagatggaggaggtggccatcgagagggaccaggcc
atcgccacgcgggaggggctgcacgcacagcactctcggagcctgcaggagaaggacgcg
ctgcggaagcaggtccgggagctggccgagaaggcggacgagctccagctgcagctcttc
cagcgcgagggccagctgctggccttggagggcaggctcaagcggcagcagctggacgcg
ctcgtcctgagctctgacctagaggacagctcacccaggaactcccaggagctctcgctc
tccctggacctggaggccgtccagctctcagacaaaggtggcctggccaacagggacagc
ccccagcagccctctgtggctctgcaggaggagcggcttccactgaccgccaacgacgca
ggccagggcggcggggagccccccgagaaggagcggcggcgcctcaaggagagcttcgag
aactaccgcaggaagcgcgccctcaggaagatgcagcatggctcgaggcagggggaggtg
gactgggagaacaccacgggcagcgacaacaccgacaccgagggctcctag

KEGG   Ursus arctos horribilis: 113248628
Entry
113248628         CDS       T05909                                 

Gene name
CARD9
Definition
(RefSeq) caspase recruitment domain-containing protein 9 isoform X1
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
uah  Ursus arctos horribilis
Pathway
uah04621  NOD-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah05152  Tuberculosis
uah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113248628 (CARD9)
   04625 C-type lectin receptor signaling pathway
    113248628 (CARD9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113248628 (CARD9)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113248628 (CARD9)
SSDB
Motif
Pfam: CARD CARD_2 CxC5
Other DBs
NCBI-GeneID: 113248628
NCBI-ProteinID: XP_026345975
UniProt: A0A3Q7V273
LinkDB
Position
Unknown
AA seq 536 aa
MSDYENEDQCWSALESFRVKLISVIDPSRITPYLRQCKVLNPDDEEQVLSDPSLVIRKRK
VGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPTRVFSMIIDASGESGLTQLLM
SEVLKLQRKVQDLNQLLSSKDDLIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKD
ENYDLAMRLARQSEEKGAALMRSRDLQLEIERLKHSLMRAEDDCRVERKHTLKLRHAMEQ
RPSQELVWQLQQEKTLLQARVQELEATMQDGKPDKSSPYIQVLEEDWRQALQDHQEQANT
ILSLRKDLRQGEALRARCVEEKEMFELQCLALRKDSKMYKDRIEAILQQMEEVAIERDQA
IATREGLHAQHSRSLQEKDALRKQVRELAEKADELQLQLFQREGQLLALEGRLKRQQLDA
LVLSSDLEDSSPRNSQELSLSLDLEAVQLSDKGGLANRDSPQQPSVALQEERLPLTANDA
GQGGGEPPEKERRRLKESFENYRRKRALRKMQHGSRQGEVDWENTTGSDNTDTEGS
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgtcagactatgagaacgaggaccagtgctggagtgctctagagagcttccgcgtgaag
ctcatctctgtcatcgacccctcacgcatcacaccctacctgaggcagtgcaaggtgctg
aaccccgatgatgaggagcaggtgctcagtgaccccagcctggtcatccgcaagcggaaa
gtgggcgtgctcctggacatcctgcagcggaccggccacaagggctacgtggccttcctc
gagagcctggagctctactacccgcagctctacaagaaggtcacgggcaaggagcccacc
cgtgtcttctccatgatcatcgacgcatccggggagtcaggcctgacgcagctgctgatg
agcgaggtgctgaagctgcagaggaaagtgcaggacctgaaccagctgctgagctccaag
gatgacctcatcaaggagctgcgggtgaaggacagcctgctccgcaagcaccaggagcgt
gtgcagcggctcaaggaggagtgtgaggcgggcagccgtgagctcaagcgctgcaaggat
gagaactacgacctagccatgcgcctggcccgccagagcgaggagaagggcgccgcgctc
atgcgcagccgcgacctgcagctggagatcgagcggctcaagcacagcctcatgagggcc
gaggacgactgcagggtggagcgcaagcacacgctgaagctcaggcacgccatggagcag
cggcccagccaggagctcgtgtggcagctgcagcaggagaagactttgctgcaggctcgc
gtgcaggagctggaggccaccatgcaggacgggaagccagacaagagcagcccctatatc
caagtgctggaggaggattggcgacaggcacttcaggaccaccaagagcaagccaacacc
atcctctctctgcgcaaggacctgcggcagggcgaggctctgcgcgcccggtgcgtggaa
gagaaggagatgtttgagctgcagtgcctggcgctacggaaggactccaagatgtacaag
gaccgcatcgaggccatcctgcagcagatggaggaggtggccatcgagagggaccaggcc
atcgccacgcgggaggggctgcacgcacagcactctcggagcctgcaggagaaggacgcg
ctgcggaagcaggtccgggagctggccgagaaggcggacgagctccagctgcagctcttc
cagcgcgagggccagctgctggccttggagggcaggctcaagcggcagcagctggacgcg
ctcgtcctgagctctgacctagaggacagctcacccaggaactcccaggagctctcgctc
tccctggacctggaggccgtccagctctcagacaaaggtggcctggccaacagggacagc
ccccagcagccctctgtggctctgcaggaggagcggcttccactgaccgccaacgacgca
ggccagggcggcggggagccccccgagaaggagcggcggcgcctcaaggagagcttcgag
aactaccgcaggaagcgcgccctcaggaagatgcagcatggctcgaggcagggggaggtg
gactgggagaacaccacgggcagcgacaacaccgacaccgagggctcctag

DBGET integrated database retrieval system