KEGG   Ursus arctos horribilis: 113248581
Entry
113248581         CDS       T05909                                 

Gene name
CCL20
Definition
(RefSeq) C-C motif chemokine 20
  KO
K14625  C-C motif chemokine 20
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04657  IL-17 signaling pathway
uah04668  TNF signaling pathway
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    113248581 (CCL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113248581 (CCL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113248581 (CCL20)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    113248581 (CCL20)
   04062 Chemokine signaling pathway
    113248581 (CCL20)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113248581 (CCL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113248581 (CCL20)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113248581 (CCL20)
SSDB
Motif
Pfam: IL8 ST7
Other DBs
NCBI-GeneID: 113248581
NCBI-ProteinID: XP_026345912
UniProt: A0A3Q7W6H0
LinkDB
Position
Unknown
AA seq 97 aa
MMGSSKNLLLAALMAVLVFYLCSTSEAASNFDCCLRYTEHVLHPRSLVGFTQQLANEACD
INAVIFYTKKRLAVCADPKKNWVKKAVQILSHRVKKM
NT seq 294 nt   +upstreamnt  +downstreamnt
atgatgggcagtagcaagaatttgctcctggctgctttgatggcagtgctggtattctac
ttatgcagcacgtcagaagcagcaagcaactttgattgctgtcttcgatatacagaacat
gtccttcatcccagatctcttgtgggcttcacacagcagctggccaatgaagcttgcgac
atcaacgccgtcatcttttacacaaagaaaagattggctgtgtgtgcagatccaaagaag
aactgggtgaaaaaggctgtgcaaatcctcagccacagagtcaagaagatgtaa

DBGET integrated database retrieval system