KEGG   Ursus arctos horribilis: 113248591
Entry
113248591         CDS       T05909                                 

Definition
(RefSeq) TNF receptor-associated factor 2 isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04064  NF-kappa B signaling pathway
uah04071  Sphingolipid signaling pathway
uah04141  Protein processing in endoplasmic reticulum
uah04210  Apoptosis
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04668  TNF signaling pathway
uah04920  Adipocytokine signaling pathway
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah05010  Alzheimer disease
uah05016  Huntington disease
uah05017  Spinocerebellar ataxia
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05160  Hepatitis C
uah05163  Human cytomegalovirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113248591
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113248591
   04064 NF-kappa B signaling pathway
    113248591
   04668 TNF signaling pathway
    113248591
   04071 Sphingolipid signaling pathway
    113248591
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113248591
   04217 Necroptosis
    113248591
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113248591
   04622 RIG-I-like receptor signaling pathway
    113248591
   04657 IL-17 signaling pathway
    113248591
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113248591
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113248591
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113248591
   05203 Viral carcinogenesis
    113248591
  09162 Cancer: specific types
   05222 Small cell lung cancer
    113248591
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113248591
   05016 Huntington disease
    113248591
   05017 Spinocerebellar ataxia
    113248591
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113248591
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113248591
   05135 Yersinia infection
    113248591
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113248591
   05160 Hepatitis C
    113248591
   05168 Herpes simplex virus 1 infection
    113248591
   05163 Human cytomegalovirus infection
    113248591
   05167 Kaposi sarcoma-associated herpesvirus infection
    113248591
   05169 Epstein-Barr virus infection
    113248591
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:uah03019]
    113248591
   04121 Ubiquitin system [BR:uah04121]
    113248591
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113248591
Messenger RNA biogenesis [BR:uah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     113248591
Ubiquitin system [BR:uah04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    113248591
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 SlyX MATH
Other DBs
NCBI-GeneID: 113248591
NCBI-ProteinID: XP_026345921
UniProt: A0A3Q7UCD1
LinkDB
Position
Unknown
AA seq 539 aa
MTCSVFFLRAWRFAALMAAASVTPPGSLDLLQPGFSKTLLGTKPEDKYLCSACKNVLRRP
FQAQCGHRYCSYCLTSILSSGPQNCAACVHEGIYEEGVSILESGSAFPDNAARREVESLP
AVCPSDGCTWKGTLKEYESCHEGHCPFMLTECPACKGLVRLGEKERHSEQECPERSLSCR
HCRAPCCWADLKAHHEVCPKFPLTCDGCGKKKISREKFQDHVRACGKCRVPCRFHIVGCP
EMVESEKQQQHEAQWLREHLGMLLGGLLETKPLSGAGGRFLGQSEVGGWEASTLHPEAEL
SKAAELRQRCEALERKTATFENIVCVLNREVERVAMTAEACGRQHRLDQDRIEALSNKVQ
QLERSIGLKDLAMAELEQKVHEMEATTFDGVFIWKISDFARKRQEAVAGRTPAIFSPAFY
TSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGPNDALLRWPFNQKVTLMLLDQNNREH
VIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgacgtgctctgtgttcttccttagggcgtggcggttcgcagctctcatggctgcagcc
agtgtgacccctcccggctccctagatctgttgcagcctggcttctcgaagaccctcctg
gggaccaagccggaggacaagtatctgtgctcggcctgcaagaacgtcctgcgcaggcct
ttccaggctcagtgcggccaccgctactgctcctactgtctgaccagcatcctgagctcc
gggcctcagaactgtgctgcctgtgttcacgagggcatatatgaggaaggcgtctcgatt
ttggaaagtggttcggctttcccagacaacgctgcacgcagggaggtggagagcctgcca
gccgtctgtcccagcgacggctgcacctggaaggggacccttaaagagtatgagagctgc
catgaaggacactgcccgttcatgctgaccgagtgcccggcgtgcaaaggcctggttcgc
ctcggggagaaggagcgtcactcggagcaggaatgcccggagagaagcctcagctgcagg
cactgccgggcgccctgctgctgggcggacctgaaggcgcaccatgaggtctgccccaag
ttccccttgacttgcgatggctgtggcaagaagaagatctcacgggagaaattccaggac
cacgtcagggcgtgcggcaagtgccgagtcccgtgcaggttccacattgtcggctgcccc
gagatggtggagagcgagaagcagcagcagcatgaggcccagtggctccgggagcacttg
ggcatgctgctgggcggcctcctggagaccaagccactctcaggagcaggtggccgcttc
ctgggccagagcgaagtggggggctgggaagccagcacgctgcaccctgaggcggagctc
tccaaggctgcagagctccggcaacggtgtgaggccctggagaggaagacggccaccttc
gagaacatcgtctgcgtcctgaaccgggaggtagagagggtggccatgactgctgaggcc
tgcggccggcagcaccggctggaccaggacaggatcgaggccctgagtaacaaggtgcag
cagctggagaggagcatcggtctgaaggacctggcgatggctgagctggagcagaaggtc
cacgagatggaggcgaccaccttcgatggtgtgttcatctggaagatatccgacttcgcc
aggaagcgtcaggaagcggtggctggccgcacgcccgccatcttctccccagccttctac
acgagcaggtacggctacaagatgtgtctgcgcatctacctgaacggggacggcaccggc
cgggggacacacctgtctctcttctttgtggtgatgaggggccccaacgacgcgctgctg
cggtggcccttcaaccagaaggtgaccttaatgctgcttgaccagaacaaccgggagcac
gtgattgacgccttcagacccgacgtgacctcgtcctctttccagaggccggtcagtgac
atgaacatcgccagcggctgccccctcttttgccccgtctccaagatggaggccaagaat
tcctacgtgcgtgacgacgccatcttcatcaaggccatagtggacctgacggggctctag

KEGG   Ursus arctos horribilis: 113248645
Entry
113248645         CDS       T05909                                 

Definition
(RefSeq) TNF receptor-associated factor 2 isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04064  NF-kappa B signaling pathway
uah04071  Sphingolipid signaling pathway
uah04141  Protein processing in endoplasmic reticulum
uah04210  Apoptosis
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04668  TNF signaling pathway
uah04920  Adipocytokine signaling pathway
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah05010  Alzheimer disease
uah05016  Huntington disease
uah05017  Spinocerebellar ataxia
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05160  Hepatitis C
uah05163  Human cytomegalovirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113248645
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113248645
   04064 NF-kappa B signaling pathway
    113248645
   04668 TNF signaling pathway
    113248645
   04071 Sphingolipid signaling pathway
    113248645
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113248645
   04217 Necroptosis
    113248645
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113248645
   04622 RIG-I-like receptor signaling pathway
    113248645
   04657 IL-17 signaling pathway
    113248645
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113248645
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113248645
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113248645
   05203 Viral carcinogenesis
    113248645
  09162 Cancer: specific types
   05222 Small cell lung cancer
    113248645
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113248645
   05016 Huntington disease
    113248645
   05017 Spinocerebellar ataxia
    113248645
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113248645
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113248645
   05135 Yersinia infection
    113248645
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113248645
   05160 Hepatitis C
    113248645
   05168 Herpes simplex virus 1 infection
    113248645
   05163 Human cytomegalovirus infection
    113248645
   05167 Kaposi sarcoma-associated herpesvirus infection
    113248645
   05169 Epstein-Barr virus infection
    113248645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:uah03019]
    113248645
   04121 Ubiquitin system [BR:uah04121]
    113248645
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113248645
Messenger RNA biogenesis [BR:uah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     113248645
Ubiquitin system [BR:uah04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    113248645
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 SlyX MATH
Other DBs
NCBI-GeneID: 113248645
NCBI-ProteinID: XP_026346000
UniProt: A0A3Q7UCD1
LinkDB
Position
Unknown
AA seq 539 aa
MTCSVFFLRAWRFAALMAAASVTPPGSLDLLQPGFSKTLLGTKPEDKYLCSACKNVLRRP
FQAQCGHRYCSYCLTSILSSGPQNCAACVHEGIYEEGVSILESGSAFPDNAARREVESLP
AVCPSDGCTWKGTLKEYESCHEGHCPFMLTECPACKGLVRLGEKERHSEQECPERSLSCR
HCRAPCCWADLKAHHEVCPKFPLTCDGCGKKKISREKFQDHVRACGKCRVPCRFHIVGCP
EMVESEKQQQHEAQWLREHLGMLLGGLLETKPLSGAGGRFLGQSEVGGWEASTLHPEAEL
SKAAELRQRCEALERKTATFENIVCVLNREVERVAMTAEACGRQHRLDQDRIEALSNKVQ
QLERSIGLKDLAMAELEQKVHEMEATTFDGVFIWKISDFARKRQEAVAGRTPAIFSPAFY
TSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGPNDALLRWPFNQKVTLMLLDQNNREH
VIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgacgtgctctgtgttcttccttagggcgtggcggttcgcagctctcatggctgcagcc
agtgtgacccctcccggctccctagatctgttgcagcctggcttctcgaagaccctcctg
gggaccaagccggaggacaagtatctgtgctcggcctgcaagaacgtcctgcgcaggcct
ttccaggctcagtgcggccaccgctactgctcctactgtctgaccagcatcctgagctcc
gggcctcagaactgtgctgcctgtgttcacgagggcatatatgaggaaggcgtctcgatt
ttggaaagtggttcggctttcccagacaacgctgcacgcagggaggtggagagcctgcca
gccgtctgtcccagcgacggctgcacctggaaggggacccttaaagagtatgagagctgc
catgaaggacactgcccgttcatgctgaccgagtgcccggcgtgcaaaggcctggttcgc
ctcggggagaaggagcgtcactcggagcaggaatgcccggagagaagcctcagctgcagg
cactgccgggcgccctgctgctgggcggacctgaaggcgcaccatgaggtctgccccaag
ttccccttgacttgcgatggctgtggcaagaagaagatctcacgggagaaattccaggac
cacgtcagggcgtgcggcaagtgccgagtcccgtgcaggttccacattgtcggctgcccc
gagatggtggagagcgagaagcagcagcagcatgaggcccagtggctccgggagcacttg
ggcatgctgctgggcggcctcctggagaccaagccactctcaggagcaggtggccgcttc
ctgggccagagcgaagtggggggctgggaagccagcacgctgcaccctgaggcggagctc
tccaaggctgcagagctccggcaacggtgtgaggccctggagaggaagacggccaccttc
gagaacatcgtctgcgtcctgaaccgggaggtagagagggtggccatgaccgctgaggcc
tgcggccggcagcaccggctggaccaggacaggatcgaggccctgagtaacaaggtgcag
cagctggagaggagcatcggtctgaaggacctggcgatggctgagctggagcagaaggtc
cacgagatggaggcgaccaccttcgatggtgtgttcatctggaagatatccgacttcgcc
aggaagcgtcaggaagcggtggctggccgcacgcccgccatcttctccccagccttctac
acgagcaggtacggctacaagatgtgtctgcgcatctacctgaacggggacggcaccggc
cgggggacacacctgtctctcttctttgtggtgatgaggggccccaacgacgcgctgctg
cggtggcccttcaaccagaaggtgaccttaatgctgcttgaccagaacaaccgggagcac
gtgattgacgccttcagacccgacgtgacctcgtcctctttccagaggccggtcagtgac
atgaacatcgccagcggctgccccctcttttgccccgtctccaagatggaggccaagaat
tcctacgtgcgtgacgacgccatcttcatcaaggccatagtggacctgacggggctctag

KEGG   Ursus arctos horribilis: 113265029
Entry
113265029         CDS       T05909                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04064  NF-kappa B signaling pathway
uah04120  Ubiquitin mediated proteolysis
uah04140  Autophagy - animal
uah04144  Endocytosis
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04722  Neurotrophin signaling pathway
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05222  Small cell lung cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    113265029 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113265029 (TRAF6)
   04064 NF-kappa B signaling pathway
    113265029 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113265029 (TRAF6)
   04140 Autophagy - animal
    113265029 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113265029 (TRAF6)
   04621 NOD-like receptor signaling pathway
    113265029 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    113265029 (TRAF6)
   04657 IL-17 signaling pathway
    113265029 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113265029 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113265029 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113265029 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113265029 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    113265029 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113265029 (TRAF6)
   05135 Yersinia infection
    113265029 (TRAF6)
   05133 Pertussis
    113265029 (TRAF6)
   05152 Tuberculosis
    113265029 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113265029 (TRAF6)
   05162 Measles
    113265029 (TRAF6)
   05161 Hepatitis B
    113265029 (TRAF6)
   05160 Hepatitis C
    113265029 (TRAF6)
   05168 Herpes simplex virus 1 infection
    113265029 (TRAF6)
   05169 Epstein-Barr virus infection
    113265029 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113265029 (TRAF6)
   05140 Leishmaniasis
    113265029 (TRAF6)
   05142 Chagas disease (American trypanosomiasis)
    113265029 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113265029 (TRAF6)
   04121 Ubiquitin system [BR:uah04121]
    113265029 (TRAF6)
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113265029 (TRAF6)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    113265029 (TRAF6)
Ubiquitin system [BR:uah04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    113265029 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 Tropomyosin_1 SlyX Spc29 U-box DUF16 DUF4455 Med21 PspA_IM30 DUF3450 EzrA UPF0242 Laminin_II CENP-F_leu_zip Sina DUF1664
Other DBs
NCBI-GeneID: 113265029
NCBI-ProteinID: XP_026367880
UniProt: A0A3Q7W437
LinkDB
Position
Unknown
AA seq 541 aa
MSLLNCENSCGSSQSESDCCAAMASSCSAAAKDDSVSGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMNCPQCQRPFQKCQLNIHILK
ECPRRQVSCMNCAALMAFEDKEMHDQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAPI
PCTFSTFGCHVKMQRNHLARHLQENTQSHMRMLAQAVQSLSLALAPVPQRDMPPYDSSSV
SRVSTPCHPEVHNFQETIQQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKV
AEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQ
RCANYISLFVHTMQGEYDSHLPWPFQGTIRLAILDQSEAPVRQNHEEIMDAKPELLAFQR
PTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSG
T
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gccgccatggccagctcctgtagcgctgcagcaaaagatgacagtgtgagtggaaccgcc
agcacggggaacctctccagctcttttatggaagagatccaggggtacgatgtggagttt
gacccacccctagaaagcaagtatgaatgtcccatctgcctgatggcgttacgggaagcg
gtacaaacaccatgtggccacaggttctgcaaagcttgcatcatcaaatcaataagggat
gctggtcacaaatgtccagttgacaatgaaatattgctggaaaatcaactatttcctgac
aattttgcaaaacgagagattctttctctgatggtgaagtgtccaaatgaaggttgtttg
cacaagatggaactgaggcatcttgaggatcaccaagcacattgtgagtttgctctcatg
aattgtccccagtgccaacgtcccttccaaaaatgccaacttaatattcacattcttaag
gagtgcccaaggagacaagtttcttgcatgaactgtgctgcgttgatggcatttgaagat
aaagagatgcatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatacc
atgctcatcagagaacagatgcctaatcactatgatctagactgtccaacagccccaatt
ccatgcacattcagtactttcggttgccatgtaaagatgcagaggaatcacttggcacgc
cacctacaagagaatacgcagtcgcacatgagaatgttggctcaggctgttcagagttta
agtcttgctttagctcctgtacctcagcgtgatatgccgccgtatgattcttcctctgtg
tcccgggtctctactccgtgtcacccagaggtccataatttccaagaaaccattcagcag
ttagagggtcgcctcgtaagacaagaccatcaaatccgagagctgactgctaaaatggaa
actcagagcatgtatgtaagtgagctcaagcgaactattcgaacccttgaagacaaagtt
gctgaaatagaggcgcagcagtgcaacggcatctacatctggaagatcggcaactttggg
atgcatttgaagtctcaggaagaggagaaacctgttgtcattcacagccctggattctac
acaggcaaacccggctacaaactgtgcatgcgcctgcacctgcagttaccgaccgctcag
cgctgcgctaattatatatccctctttgtccacaccatgcaaggggagtatgacagccac
ctcccttggcccttccagggtacaatacgccttgcaattcttgatcagtctgaagcacct
gtaaggcaaaaccatgaagagatcatggatgccaaaccagagctgcttgccttccagaga
cccacaatcccacggaacccaaaaggttttggctatgtgacttttatgcatctggaagcc
ctaagacaaagaaccttcattaaggatgatactttactagtacgctgtgaggtctctacc
cgcttcgacatgggcagtctccggagggagggttttcagccacgaagtactgattcgggg
acatag

DBGET integrated database retrieval system