KEGG   Ursus arctos horribilis: 113248784
Entry
113248784         CDS       T05909                                 

Gene name
IRF7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
uah  Ursus arctos horribilis
Pathway
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05164  Influenza A
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113248784 (IRF7)
   04621 NOD-like receptor signaling pathway
    113248784 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    113248784 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    113248784 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113248784 (IRF7)
  09172 Infectious disease: viral
   05162 Measles
    113248784 (IRF7)
   05164 Influenza A
    113248784 (IRF7)
   05161 Hepatitis B
    113248784 (IRF7)
   05160 Hepatitis C
    113248784 (IRF7)
   05168 Herpes simplex virus 1 infection
    113248784 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113248784 (IRF7)
   05169 Epstein-Barr virus infection
    113248784 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113248784 (IRF7)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    113248784 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 113248784
NCBI-ProteinID: XP_026346160
UniProt: A0A3Q7V2J9
LinkDB
Position
Unknown
AA seq 503 aa
MAEAPERGPPRLLFGDWLLGEVSSGRYEGLRWLDAARTRFRVPWKHFARKDLGEADSRIF
KAWAVARGRWPPSSSSGGDQLALERTLRASWKTNFRCALRSTQRFVMLQDSSGDPTDPHK
VYGLSSKLGWRGAGIHQGEEKAREDALPSMGGFPRPCLAGDAGESPGLGLRPEPCAPSPL
FSPAGNAGDLLLQALQQSCLEDHLLEAAWGAEPAPPEAPGPELPETEPSLPRAVELAPMH
QAQVTDAALERWQPSRGTEPCPPVAGEQILARPGRAPPAAQAEPSLRALDVTIMYKGRTV
LQEVVWHPSFVLLYGPPSPAAAATAPQHVAFPSPAELPDQKQLHYTEKLLQHVAPGLQLE
LRGHGLWARRLGKCKVYWEVGGPLGSASPSTPPRLLQRNQDTPIFDFGTFFREMMEFRAR
RRRGSPHYTIYLGFGQDLSAGRPKEKSLVLVKLEPRLCRAHLECVQREGVSSLDSSSLGL
CLSSSNSLYEDLEHFLMEVGQPA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggccgaggctccggagaggggccccccgcgcctgctgttcggagactggcttctgggg
gaggtcagcagcggccgatacgaaggcctgcggtggctggacgcggcccgcacgcgcttc
cgcgtgccctggaagcacttcgcgcggaaagacctgggggaggcggattcacgcatcttc
aaggcctgggctgtcgcgcgcggcaggtggccgcccagcagcagcagcggcggtgaccag
ttggcccttgagcgcacactccgtgccagctggaaaaccaacttccgctgtgcgctacgc
agcacgcagcgtttcgtgatgctgcaagacagctcgggggaccccactgacccgcataaa
gtgtacgggctcagctccaagctggggtggagaggtgcgggcattcaccagggggaggag
aaggcccgtgaagatgccctgccctcgatgggtgggtttcctaggccatgcctggcagga
gacgctggtgagagcccagggctcgggctgagacctgagccatgtgccccaagccccctc
tttagcccagctggcaacgctggggacctcttgctccaggctctacagcagagctgcctg
gaggaccatctgctggaagctgcatggggggcggagccagcccccccagaggctcctggc
ccagagctcccggaaacggagccatccctgccaagggcagtagagctggcccccatgcac
caggcccaggtgacagatgcagccctggagcgctggcagccctctcgagggacggagccc
tgccccccagtggcaggtgagcagatcctggccaggcctggccgcgcccccccagcagcc
caggcagagcccagcctcagggccctggatgtgaccatcatgtacaagggccgcaccgtg
ctgcaggaggtggtgtggcaccccagctttgtgctcctgtacggacccccaagcccagcc
gctgcggccacagcgccccagcacgtggccttcccgagcccggccgagctccctgaccag
aagcagctgcactacaccgagaagctgctgcagcacgtggcccctgggctgcagctggag
ttgcgggggcacgggctgtgggcccggcgcctgggcaaatgcaaggtctattgggaggtg
ggcgggcccctgggctctgccagcccctccacacccccccgcctgctgcaaaggaaccag
gacacccccatcttcgacttcggcaccttcttccgagagatgatggagttccgggctcgc
cggcgtcggggctccccacactacaccatctacctgggctttgggcaggacctgtcagct
gggaggcccaaggagaagagcctggtcctggtgaagctggagccacggctgtgccgggcg
cacctggagtgcgtgcagcgagaaggggtgtcctccctggacagcagcagcctcggcctc
tgcctgtccagctccaacagcctctacgaagaccttgagcacttcctcatggaggtgggg
cagccggcctga

DBGET integrated database retrieval system