KEGG   Ursus arctos horribilis: 113249941
Entry
113249941         CDS       T05909                                 

Definition
(RefSeq) growth-regulated alpha protein-like
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04668  TNF signaling pathway
uah05134  Legionellosis
uah05146  Amoebiasis
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113249941
   04668 TNF signaling pathway
    113249941
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113249941
   04061 Viral protein interaction with cytokine and cytokine receptor
    113249941
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113249941
   04657 IL-17 signaling pathway
    113249941
   04062 Chemokine signaling pathway
    113249941
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113249941
  09171 Infectious disease: bacterial
   05134 Legionellosis
    113249941
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    113249941
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113249941
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113249941
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113249941
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113249941
NCBI-ProteinID: XP_026347165
UniProt: A0A3Q7V535
LinkDB
Position
Unknown
AA seq 75 aa
MARAATPAAPRALRLLGAALLLLLLVPAGRRAAGAPVVAELRCQCLQTLQGIHLKNIQNV
KVTPSGPHCAQTEVM
NT seq 228 nt   +upstreamnt  +downstreamnt
atggcccgcgccgccacccccgccgcaccccgcgccctccggctcctcggcgccgcgctg
ctgctcctgctcctggtccccgccggccgccgcgccgcaggagcgcccgtggtcgccgaa
ctgcgctgccagtgcttgcagaccttgcagggaattcacctcaagaacatccagaatgtc
aaggtgacgccgtcgggaccccactgcgcccaaaccgaagtcatgtaa

KEGG   Ursus arctos horribilis: 113249943
Entry
113249943         CDS       T05909                                 

Definition
(RefSeq) growth-regulated alpha protein-like
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04668  TNF signaling pathway
uah05134  Legionellosis
uah05146  Amoebiasis
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113249943
   04668 TNF signaling pathway
    113249943
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113249943
   04061 Viral protein interaction with cytokine and cytokine receptor
    113249943
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113249943
   04657 IL-17 signaling pathway
    113249943
   04062 Chemokine signaling pathway
    113249943
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113249943
  09171 Infectious disease: bacterial
   05134 Legionellosis
    113249943
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    113249943
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113249943
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113249943
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113249943
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113249943
NCBI-ProteinID: XP_026347166
UniProt: A0A3Q7UFQ5
LinkDB
Position
Unknown
AA seq 75 aa
MARAATPAAPRALRLLGAALLLLLLVPAGRRAAGAPVAAELRCQCLQTLQGIHLKNIQNV
KVTPSGPHCAQTEVM
NT seq 228 nt   +upstreamnt  +downstreamnt
atggcccgcgccgccacccccgccgcaccccgcgccctccggctcctcggcgccgcgctg
ctgctcctgctcctggtccccgccggccgccgcgccgcaggagcgcccgtggccgccgaa
ctgcgctgccagtgcttgcagaccttgcagggaattcacctcaagaacatccagaatgtc
aaggtgacgccgtcgggaccccactgcgcccaaaccgaagtcatgtaa

KEGG   Ursus arctos horribilis: 113263276
Entry
113263276         CDS       T05909                                 

Definition
(RefSeq) growth-regulated alpha protein-like
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04668  TNF signaling pathway
uah05134  Legionellosis
uah05146  Amoebiasis
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113263276
   04668 TNF signaling pathway
    113263276
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113263276
   04061 Viral protein interaction with cytokine and cytokine receptor
    113263276
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113263276
   04657 IL-17 signaling pathway
    113263276
   04062 Chemokine signaling pathway
    113263276
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113263276
  09171 Infectious disease: bacterial
   05134 Legionellosis
    113263276
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    113263276
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113263276
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113263276
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113263276
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113263276
NCBI-ProteinID: XP_026365753
UniProt: A0A3Q7WVC1
LinkDB
Position
Unknown
AA seq 107 aa
MARAATPAAPRALRLLGAALLLLLLVPAGRRAAGAPVAAELRCQCLQTLQGIHLKNIQNV
KVTPSGPHCAQTEVIATLKNGQEVCLNPEAPMVKKIINKMLNKGSTN
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcccgcgccgccacccccgccgcaccccgcgccctccggctcctcggcgccgcgctg
ctgctcctgctcctggtccccgccggccgccgcgccgcaggagcgcccgtggccgccgaa
ctgcgctgccagtgcttgcagaccttgcagggaattcacctcaagaacatccagaatgtc
aaggtgacgccgtcgggaccccactgcgcccaaaccgaagtcatagccactctcaagaat
ggacaggaggtgtgtctcaaccccgaagcccccatggtcaagaaaatcatcaataagatg
ctgaacaagggcagcaccaactga

KEGG   Ursus arctos horribilis: 113263277
Entry
113263277         CDS       T05909                                 

Definition
(RefSeq) growth-regulated protein homolog gamma-like isoform X1
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04668  TNF signaling pathway
uah05134  Legionellosis
uah05146  Amoebiasis
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113263277
   04668 TNF signaling pathway
    113263277
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113263277
   04061 Viral protein interaction with cytokine and cytokine receptor
    113263277
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113263277
   04657 IL-17 signaling pathway
    113263277
   04062 Chemokine signaling pathway
    113263277
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113263277
  09171 Infectious disease: bacterial
   05134 Legionellosis
    113263277
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    113263277
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113263277
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113263277
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113263277
SSDB
Motif
Pfam: IL8 Trp_oprn_chp
Other DBs
NCBI-GeneID: 113263277
NCBI-ProteinID: XP_026365754
UniProt: A0A3Q7XH80
LinkDB
Position
Unknown
AA seq 105 aa
MARAATPAAPRALRLLGAALLLLLLVPAGRRAAGVLVAAELRCQCLQTLQGIHLKNIQNV
KVTPSGPHCAQTEVIATLKNGQEVCLNPEAPMVKKIINKMLNNSN
NT seq 318 nt   +upstreamnt  +downstreamnt
atggcccgcgccgccacccccgccgcaccccgcgccctccggctcctcggcgccgcgctg
ctgctcctgctcctggtccccgccggccgccgcgccgcaggagtgctcgtggccgccgaa
ctgcgctgccagtgcttgcagaccttgcagggaattcacctcaagaacatccagaatgtg
aaggtgacgccgtcgggaccccactgcgcccaaaccgaagtcatagccactctcaagaat
ggacaggaggtgtgtctcaaccccgaagcccccatggtcaagaaaatcatcaataagatg
ctgaacaactccaactga

DBGET integrated database retrieval system