KEGG   Ursus arctos horribilis: 113250298
Entry
113250298         CDS       T05909                                 

Gene name
COL6A3
Definition
(RefSeq) collagen alpha-3(VI) chain isoform X1
  KO
K06238  collagen, type VI, alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04512  ECM-receptor interaction
uah04974  Protein digestion and absorption
uah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113250298 (COL6A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    113250298 (COL6A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113250298 (COL6A3)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    113250298 (COL6A3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113250298 (COL6A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113250298 (COL6A3)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113250298 (COL6A3)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113250298 (COL6A3)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   113250298 (COL6A3)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   113250298 (COL6A3)
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_3 Kunitz_BPTI fn3
Other DBs
NCBI-GeneID: 113250298
NCBI-ProteinID: XP_026347394
UniProt: A0A3Q7VXY5
LinkDB
Position
Unknown
AA seq 3187 aa
MRKHRHLPLVAMFCLFLSGFSLTRAQQQQADVKNGAAADIIFLVDSSWSIGKEHFQLVRE
FLYDVIESLAVGDSDFRFALVQFNGNPHTEFLLNTYRTKQEVLSHISNMSYIGGSNETGK
GLEYVMQNHLTEAAGSRAGDGVPQVIVVLTDGHSDDGLALPSAGLKSADVNVFAIGVEDA
DEGALKEIASEPLTMHVFNLENFTSLHDIVGNLVSCVQSSVAPEGAGGTETLKDITAQDS
ADIIFLIDGSNNTGSVHFAVIRDFLVNLLERLSVGAQQIRVGVVQYSDEPRTVFSLDTYS
TKAQVLDAVKALAFTGGELANVGLALDFVVENHFTRAGGSRVEEGVPQVLVLISAGPSSD
EIRDGVVALKQASVFSFGLGAQAASRAELQHIATNDNLVFTVPEFRSFGDLQEQLLPYIV
GVAQRHIVLQPPTIVTEVIEVNKRDIVFLVDGSSSLGLANFNAIRDFIAKVIQRLEIGQD
LIQVAVAQYADTVRPEFYFNSYPNKREVITAVRRMKPMEGSVLYTGSALDFVRNNLFTSS
AGHRAAEGVPKLLVLITGGKSLDEISQPAQELKRSSIMSFAVGSKAADQAELEEIAFDSS
LVFLPAEFRAAPLQGVLPGLLAPLRTLSGTSEVHVNKRDIIFLLDGSSNVGKTNFPYVRD
FVTNVVNSLDVGSDNIRVGLVQFSDTPVTEFSLDTYQTKAELLAHLRRLQPQGGSGLNTG
SALSYVHANHFTEAGGSRSREHVPQLLLLLTAGPAEDAYLPAANALARAGVLTLCVGASR
ANKAELEQIAFNPSLVYLMDDFSSLPALPQQLIQPLTTYVSGGVEEVPLAQPESKRDILF
LFDGSANLVGQFPAVRDFLYKVIDELDVKPDGTRIAVAQYSDDVRVESRFDEHQNKPEIL
SLVKRMKIKTGKALNLGYALDYAQRYIFVKSAGSRIEDGVLQFLVLLVAGRSSDRLDTPA
LNLKQSGVVTFILQAKNADPAELGLMVPSPVFILAAESLPKIGDLQPQIVNLLKSVHNGA
PTPVSGEKDVVFLIDGSEGVRSGFPLLKEFVQRVVESLDVGPDRVRVAVVQYSDRTRPEF
YLNSYMDQQSVVSAVRRLTLLGGPTPNTGAALDFVLRNILISSAGSRIAEGVPQLLIVLT
ADRSGDDVRGPSVVVKRGGAVPIGIGIGNADITEMQTISFIPDFAVAIPTFRQLGTVQQV
ISDRVIQLNREELSRLQPVLLPPTSPGVGSKKDVVFLIDGSQSAGPEFQYIRTLIERLVD
YLDVGFDTTRVAVIQFSEDPRVEFLLNAHSSKDEVQNAVRRLRPKGGRQVNIGGALEYVS
RNIFKRPLGSRIEEGVPQFLVLISSGKSDDEVDDSAAELKQSGVAPFTVARNADQEELVK
ISLSPEYVFSVSTFRELPSLEQKLLTPITTLTSEQIQKILASTRYPSPAIESDAADIVFL
IDSSDSIKPDDVAHIRDFVIKIVRRLNIGPNKVRIGVVQFSNEVFPEFYLKTHKSQAAVL
DALRRLRFRGGSPLNTGRALEFVARNLFVKSAGSRIEDGVPQHLVLFLGGKSQDDISRFS
QVISSSGIVSLGVGDRNIDRTELQTITNDPRLVFTVREFRELPSIEDRVMHAFGPSGVTP
APPGVDIPSPSRPEKKKADVVFLLDGSINFRRDTFQEVLRFVSEIVDTLYEGGDSIQVGL
VQYNSDPTDEFFLKDFSTKQQIIDAINKVVYKGGRHANTKVGIEHLRQNHFVPEAGSRLD
QRVPQIAFVITGGKSVEDAQEASLALTQKGVKVFAVGVKNIDSEEVGKIASNSATAFRVG
NVQELSELSEQVLETLHDAMHETLCPGVTDISKACNLDVILGFDGSRDQNVFVTQKGLES
KVDAVLNRISQMQRISCSGGQMPTVRVSVVANTPTGPVEAFDFAEYQPELFEKFRNMRSQ
HPYVLTADTLKVYQNKFRQSSPDSVKVVIHFTDGVDGSLADLQKASEALRQEGVQALILV
GLERVANLEQLMQLEFGRGFLYNRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGQR
GDRGPIGSIGPKGIPGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGIKGSRGFP
GEKGELGEIGLDGLDGEDGDKGLPGSSGEKGNPGRRGDKGPKGDKGERGDIGIRGDPGDS
GRDSQQRGPKGETGDIGPMGLPGRDGVSGSPGETGKDGGFGRRGPAGAKGNKGGPGQPGS
VGEQGTRGAQGPPGPTGPPGLIGEQGISGPRGSGGTAGVPGERGRTGPLGRKGEPGEPGP
KGGIGSRGPRGETGDDGRDGVGGEGRRGKKGERGFPGYPGSKGAPGEPGTGGALGPKGIR
GRRGNSGPPGAVGQKGDPGYPGPSGPKGNRGDSMDQCALVQSIKDKCPCCYGPLECPVFP
TELAFALDTSEGVTQDTFSRMRDVLLKVVGDLTIAESNCPRGARVAVVTYNNEVTTEIRF
ADSKKKSVLLDKIKNLQVALTSKQQSLETAMSFVARNTFKRVRNGFLMRKVAVFFSNKPT
RASPQLREAVLKLSDAGITPLFLTSQEDGQLISALQINNTAVGHALVLPARRDLTDFLKN
VLTCHICLDICNIDPSCGFGTWRPSFRDRRAAGSDADIDMAFVLDSSESTTLFQFNEMRK
YIGYLVRQLDLSPDPKASQHLTRVAVVQHAPYESMGNVSVSPVKVEFSLTDYGSKEKLVD
FLHSRMTQLQGTRDLGRAIEYTIENVFESAPNPRDLKIMVLMLTGEVEKEQLEEAQRVIL
QAKCKGYFFVILGIGRKVNVKEVYGFASEPNDVFFKLLDKSTELNEEPLMRFGRLLPSFV
GSENAFYLSPDIRKQCDWFQGDQLSIKNPVKFGHKQLNIPNNVTSSPTTKLVTPAKPVTT
TEPVTTTTKPVATTTKPVATTTKPVTVVNLPASKPAAAKPAPPKPAAVRPVAPVRPVAAK
PEATKTATVRPAVAAKPVAAKPVAPKPAAVRPPTAARPVAAKPEAPKLQAAKPAVAKPAA
KPSREVQVSDVTENSAKLHWERPEPPGPYFYDLTVTSAHDQSLVLRQNLSVTERAVGGLL
AGHTYHVAVVCYLKSQVRAAYQASFSTKKAQPAAPQARSASSSTINLMVSTEPVAGGETD
ICKLPKEEGTCRKFMLKWYYDVETKSCMRFWYGGCSGNENRFNSQKECETVCAPALVNPG
VIAAMGT
NT seq 9564 nt   +upstreamnt  +downstreamnt
atgaggaaacatcgacatttgcccttggtggccatgttttgtctctttctctcaggcttt
tctcttacccgtgcccaacagcagcaagcagatgtcaaaaatggtgctgctgccgatata
atatttctagtggattcctcttggagcattggaaaggaacatttccaacttgttcgagag
tttctgtatgatgttatagaatctttagctgtgggagacagtgatttccgttttgctctg
gtccagttcaacggcaacccacataccgagttcctgttaaatacgtaccgtactaagcaa
gaagtcctctcccacatttccaacatgtcctatattgggggaagcaatgagactggaaaa
ggattagaatacgtaatgcagaaccacctgactgaggctgccggaagccgggccggtgac
ggagtccctcaggttatcgtagtgctaaccgatggacactcggacgacggccttgctctg
ccctcagcgggacttaagtctgctgatgttaacgtgtttgcaattggagttgaggacgca
gatgaaggagcgttaaaagaaatagcaagcgaaccgctcactatgcatgtgttcaaccta
gagaattttacctcacttcatgacatagtaggaaacttagtgtcctgtgtgcagtcatcc
gtggctccagaaggggctggaggcacagagacccttaaagacatcacagcacaagactct
gctgacattattttccttattgacggatcaaacaacaccggaagtgtccattttgcagtc
attcgcgacttccttgtaaatctccttgagagactctctgtcggagctcagcagatccga
gtgggggtggtccagtatagcgatgagcccagaaccgtgttctccttggacacctactcc
accaaggcccaggttctggatgcagtgaaagcccttgcgttcactggtggggagctggcc
aatgtcggcctcgcccttgatttcgtggtggagaaccacttcacccgggcagggggcagc
cgagtggaggaaggggttccccaggtgctggtcctcataagcgctgggccttctagtgac
gaaatccgcgacggggtggtagcactgaagcaggctagcgtgttctcatttggcctcgga
gcccaggccgcctccagggccgagcttcagcacatagccaccaatgacaacttggtgttt
actgtcccggaattccgtagctttggggacctccaggagcaattactgccgtacattgtt
ggcgtggcccaaaggcacattgtcttacaaccgccaaccattgtcacagaagtcattgaa
gtcaacaagagagacatagttttcctggtggatggctcatcctcactgggactggccaac
ttcaatgcaatccgcgacttcattgccaaagtcatccagaggctggaaatcggacaggat
cttatccaagtggcagtggctcagtacgcagacactgtgaggccagagttctatttcaat
agctaccccaataaaagggaagtcattaccgccgtgcggagaatgaaacccatggaaggc
tcggtcctgtacacgggctccgctctggactttgttcggaacaacctgttcactagttcg
gctggccaccgggccgccgagggggtccctaagctcctggtgctgattacaggcggtaag
tccctagatgaaatcagccagcctgcccaggagctgaagagaagcagcatcatgtccttt
gccgttgggagcaaggctgccgaccaggctgagctggaagagattgcttttgattcctcc
ctggtgttcctccccgccgagttccgagccgcccctctgcagggcgtgctgcccggcttg
ctggcgcctctcaggaccctctccggaacctctgaagttcacgtaaacaaaagggatatc
atctttcttttggatggatcgtccaacgttggaaagaccaatttcccttatgtgcgggac
tttgtcacgaacgtagttaacagccttgatgtcggaagcgacaatattcgtgttggttta
gtgcagtttagcgacactccggtgaccgagttctccctagacacataccagaccaaagca
gagttgcttgcccatctgaggcggctgcagccccagggggggtcgggcctgaacacgggc
tcggccctgagctatgtgcatgccaaccacttcaccgaagctggcggcagcaggagccga
gaacacgtgccgcagctcttgctcctgctcacggccgggccggccgaggacgcctacctg
ccggcggccaacgccctggcgcgcgccggcgtgctgaccctgtgtgtgggggctagccgg
gcgaacaaggccgagcttgagcagatcgcttttaacccgagcctggtgtatctcatggat
gatttcagctccctgccagctttgcctcagcagctcatccagcccctaaccacttatgtt
agtggaggtgtggaggaagtgccactcgcccagccagaaagcaagcgagacattctgttc
ctctttgacggctcagccaatctcgtgggccagttccctgcggtccgcgacttcctctac
aaggttattgacgagcttgacgtgaaaccggatgggacccggattgcggtggctcagtac
agcgatgatgtcagggtggagtcccgttttgatgagcaccagaataagcccgagatcctg
agccttgtgaagagaatgaagatcaagaccggcaaagccctcaatctgggctacgcgctg
gactacgcgcagaggtacatttttgtgaagtccgccgggagccgcatcgaggatggagtg
cttcagttcctggtgctgctggtggcgggaaggtcgtcggaccgtctggacacacctgca
ctcaacctgaaacagagcggggtggtgactttcatactgcaggccaagaacgcagaccct
gctgagctggggctgatggtgccttcccccgtctttatcctggccgccgagtcgcttccc
aagatcggagaccttcagccacagatcgtcaatctcctaaaatcagtgcacaacggggca
ccgacaccagtttcaggtgaaaaggacgtggtgtttctgattgatggctctgagggcgtc
aggagcggcttccctctgttgaaagaatttgtccagagagtcgtggagagcctggatgtg
ggcccggaccgggttcgcgtggctgtggtgcagtacagcgaccggaccagacccgagttc
tacctgaattcctacatggaccagcagagcgtggtcagcgctgtacgcaggctgacccta
ctgggagggccgacccccaacacgggggctgccctggacttcgtcctgaggaatatcctg
atcagctcggccggaagcaggatagcagaaggtgtcccccagctcctgatcgtcctcacg
gcggacaggtctggggatgacgtgaggggcccctcggtggtcgtgaagaggggaggggca
gtgcccatcggcatcggcatcgggaatgccgacatcacggagatgcagaccatctccttc
atccccgacttcgccgtggccattcctaccttccggcagctggggaccgtccagcaggtg
atctctgacagagtcatccagctcaaccgggaagagctaagcaggttgcagccagttttg
ctccccccaacgagcccgggtgttggaagcaagaaggatgtggtctttctcatcgatggg
tcccaaagtgctggtcccgaatttcagtacatccgcaccctcattgagaggctggttgac
tacctggacgtgggcttcgacacgactcgggtggcagtcatccagttcagcgaggatccc
agggtggaattcctgctgaatgcccattccagcaaggatgaagtgcagaacgccgtgagg
cggctgaggcccaaagggggaaggcaggtcaacattgggggtgccctggagtacgtgtca
aggaatatcttcaagaggcccctgggaagccggattgaagagggtgtccctcagttcctg
gtcctcatttcatccgggaagtctgatgatgaggtagacgattctgcagccgagctcaag
cagtctggtgtggcaccgtttaccgtcgcgaggaatgcagaccaggaagaactggttaag
atctccctgagccctgaatatgtgttctcagtgagcacgttccgggagctgcccagcctg
gagcagaaactgctgacccccatcacaaccctaacttcggagcagatacagaagatcctg
gccagcacccgctatccttctccagctattgagagcgatgcggcagacattgtcttccta
attgatagctctgacagcatcaagcctgatgacgttgcacatattagggacttcgtgatc
aagattgtccggagactcaacatcggccccaataaagtgaggattggggttgtacagttc
agcaatgaggtcttcccagaattctacctgaagacccataaatcccaggccgctgtgctc
gatgccttacgtcgcctgaggttcagaggggggtcaccactgaacactggcagagctctg
gaatttgtggcaagaaacctgtttgtcaagtctgctgggagccggatagaagacggggtg
ccccaacacctggttctgtttctgggtggaaaatctcaggatgatatttccaggttttca
caagtgattagctcctcagggattgtgagtttaggagtaggagaccgaaatatcgacaga
acggagctacagaccatcaccaacgaccccagactggtcttcacggtgcgagagttcaga
gagctccccagcatagaagacagggtcatgcatgcctttggaccctctggggtcacacct
gcacctccaggagtggacataccttctccctcacggccagagaaaaagaaagcagacgtt
gtgttcctgttggatggctccatcaatttcaggagggacactttccaggaagtgctccgt
ttcgtgtctgaaatcgtggacacgctgtatgaggggggtgactctatccaagtggggctg
gtccagtacaactctgaccccactgatgagttcttcctgaaggacttctccaccaagcag
cagattattgacgccatcaacaaagtggtctacaaaggggggagacacgcaaacaccaag
gtgggcatcgagcacctgcggcagaatcacttcgtgccggaggcgggcagccgcctggat
cagagggtcccgcagatagcctttgtgatcacgggtggaaagtcggtggaggacgcccag
gaggccagcctggcactcacccagaaaggggtcaaagtgttcgccgtgggcgtgaagaac
atcgactccgaggaggttgggaaaatagcgtccaacagtgccacggcgttccgagtgggg
aacgtccaggagctgtctgaattgagcgagcaagttctggaaactctgcatgatgcaatg
catgaaaccttatgtccgggagtgactgatatttccaaagcctgtaatctggatgtgatt
ctggggtttgacggatcgagggatcagaatgtatttgtgacccagaagggccttgagtcc
aaggtggatgctgtcttgaatagaatcagccagatgcaaagaatcagctgcagcggcggc
cagatgcccaccgtgcgggtgtcggtggtggccaacacgcccacaggccccgtggaggcc
ttcgactttgccgagtaccagccggagctgtttgagaaattccgtaacatgcgtagccag
cacccctatgtcctcactgcggacacgctgaaggtctatcagaacaagttccgacagtcc
tcaccggacagtgtgaaggtggtcattcatttcacggatggagtggatggaagtctggct
gatttacaaaaggcgtctgaggctctccgacaagaaggggtccaggctctgatcctggtg
ggccttgaacgggtagccaacttggagcagctgatgcagctggagttcgggcgaggcttc
ctgtacaacaggccgctgaggctaaacttgctggacctggactacgagctagcggagcag
ctcgacaacattgccgagaaagcttgctgtggcgttccctgcaaatgctccggacaaagg
ggagaccgcgggcccattggcagcatcgggccaaagggcattcccggggaggatggctat
cgaggctatcctggtgacgagggcggacccggtgagcgtgggcctcctggcgtgaacggc
actcaaggtttccagggctgccctgggcagagaggaataaagggctctcgcggattccca
ggagagaagggtgaattaggagaaatcgggctagatggtctcgacggtgaagacggagac
aaaggattgcctggttcttctggagagaaagggaatcccggtagaaggggtgacaaagga
cctaaaggggacaaaggagagagaggggacattggaattcgaggtgacccgggtgactca
ggacgggacagtcagcagagaggacccaaaggagaaactggagacattggccccatgggt
ctccctgggagagacggggtatctggaagccctggagaaaccgggaaggacggtggcttc
ggccgaaggggacctgcgggagctaagggcaacaagggcggcccgggccagccgggctcc
gtgggagagcaggggacccgaggcgcacagggtccacctggtcccacgggtcctccaggg
ctgatcggggaacaaggcatttccgggccccggggaagcggagggaccgcgggcgttcct
ggagaacgtggcaggaccgggcccctgggaagaaagggtgaacctggagagccaggaccg
aagggaggcatcgggagccggggcccccgaggggagacgggcgacgatggcagagacggg
gttggcggtgaaggacgcagaggcaaaaaaggagaaagaggattccctggatacccaggc
tcaaagggtgcccctggtgagccgggcacaggcggagcactgggacccaaaggcatcaga
ggccgaaggggaaattcaggacctccaggggcagttgggcagaagggagaccctggctac
ccaggaccatctggtcccaaaggcaacagaggggactccatggatcaatgtgcccttgtc
cagagcatcaaagataaatgtccgtgctgctatgggcccctggaatgccccgtcttcccg
acggagctggcctttgctttagacacctcggagggggtcacccaggacacgtttagccgg
atgagggatgtgctcctgaaggtcgtgggcgacctgaccattgcggagagcaactgccca
cggggggcgcgcgtggccgtggtcacctacaacaacgaggtgaccacggagatccggttc
gctgactccaagaagaagtcagtcctcctggacaagatcaagaaccttcaggtggctctg
acgtccaagcaacagagtctggaaacggccatgtccttcgtggccagaaacacgttcaag
cgcgtgaggaacggattcctgatgaggaaagtggctgttttcttcagcaataagcccacg
agggcgtccccgcagctcagggaggctgtgctgaagctctcggacgcaggcatcacaccc
ttgttcctcacaagccaggaggacgggcagctcatcagcgcgttgcagatcaataacacg
gcggtggggcatgcgctcgtcctccccgctaggagagacctcacggacttcctgaagaac
gtcctgacgtgtcacatttgcctggacatctgcaacattgacccatcctgtggattcggc
acctggaggccttccttcagggacaggcgagcggcgggcagtgatgcggacatcgacatg
gctttcgtcttagatagctctgagtccaccactctgttccagttcaacgagatgaggaag
tacatagggtacctggtcagacagctggacctgagcccagaccccaaggcctcccagcac
ttgaccagggtggccgtcgtgcaacacgctccctatgagtccatggggaacgtcagcgtg
tcacccgtgaaggtggaattctccttgactgactacggctccaaggagaagctggtggac
tttctccacagcagaatgacacagctgcaggggaccagggacctgggcagagccattgaa
tacaccatagagaacgtctttgaaagcgcccccaacccacgggacttgaaaattatggtt
ctgatgctgacgggtgaggtggagaaggagcagctggaagaggcccagagagtcatcttg
caggccaaatgcaagggttacttcttcgtgattctgggcatcggcaggaaggtgaatgtc
aaggaggtgtatggcttcgccagcgagccgaatgatgtcttcttcaaactactggataag
tcaactgagctcaatgaagagcctctgatgcgctttgggaggctgttaccatccttcgtc
ggcagtgaaaatgctttttacttgtccccagatatcaggaaacagtgtgattggttccaa
ggggaccaactgtcaattaagaatcctgtgaagttcggtcacaaacaattaaatattccg
aataatgttacttcaagtcctacaaccaaactagtgaccccagcaaagcccgtgaccacc
acagaaccggtgaccaccacgaccaaaccagtggccaccacgaccaaaccagtggccacc
acgaccaaaccagtgactgtggtaaatctgccggcctcaaagccagccgcagccaagcca
gccccacccaaaccggccgctgtgagacccgtggccccggtgaggcctgtggccgccaag
cccgaggccaccaagacggccacggtcagaccagcagtggccgcgaagccggtggccgca
aagccggtggccccgaagccagcagctgtgagaccccccactgcagccagaccagtggcc
gccaagcccgaggcccccaagctccaggcagccaaaccggccgtcgctaagcccgcggcg
aagccatcccgagaggtccaggtgtccgacgtcaccgagaacagcgccaaactccactgg
gagaggcccgaaccccctggcccttacttttatgacctcaccgtcacctcggcccacgac
cagtccctggtgctgcggcagaacctgtcggtgacggagcgcgccgtcggggggctgctc
gccgggcacacgtaccatgtggccgtggtctgctacttgaagtcccaggtcagagctgcc
tatcaagcaagtttcagcacaaagaaagctcagcctgcagccccacaagcgaggtcggct
tctagttcaaccatcaatctcatggtgagcacggaaccagtggctggtggcgagacagat
atatgcaagttgcccaaagaagaaggaacttgcaggaaattcatgttaaaatggtactac
gatgtggagaccaaaagctgcatgagattctggtacggaggctgcagtggcaacgaaaac
agatttaattcacagaaagaatgtgaaacggtttgcgctcctgcgctcgtcaaccccgga
gtcatcgcggccatggggacctaa

DBGET integrated database retrieval system