KEGG   Ursus arctos horribilis: 113250308
Entry
113250308         CDS       T05909                                 

Gene name
ACKR3
Definition
(RefSeq) atypical chemokine receptor 3
  KO
K04304  C-X-C chemokine receptor type 7 (atypical chemokine receptor 3)
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113250308 (ACKR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113250308 (ACKR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113250308 (ACKR3)
   04050 Cytokine receptors [BR:uah04050]
    113250308 (ACKR3)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    113250308 (ACKR3)
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CXC Chemokine
   113250308 (ACKR3)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 113250308
NCBI-ProteinID: XP_026347410
UniProt: A0A3Q7UGC3
LinkDB
Position
Unknown
AA seq 362 aa
MDLHLFDYPEPGNFSDIGWPCNSSDCIAVDTVLCPSMPSKSVLLYTLSFLYIFIFVIGMI
ANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVVTIPVWVVSLVQHNQWPMGELTCKIT
HLIFSINLFGSIFFLTCMSVDRYLSVTRFASTSSRRKKAVRRAVCVLVWLLAFCVSLPDT
YYLKTVTSASNNETYCRSFYPEHSVKEWLISMELVSVVLGFAIPFCVIAVFYCLLARALA
ASSDQEKQSSRRIIFSYVVVFLVCWLPYHVVVLLDIFSILHYIPFTCQLENFLFTALHVT
QCLSLVHCCVNPVLYSFISRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQN
TK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggatctgcacctcttcgactacccggagccggggaacttctccgacatcggctggccg
tgcaacagcagcgactgcatcgccgtcgacacggtgctgtgccccagcatgcccagcaag
agcgtgctgctgtacacgctgtccttcctctacatcttcatcttcgtgatcggcatgatc
gccaactccgtggtggtctgggtgaacatccaggccaagaccaccggctacgacacgcac
tgctacatcctcaacctggccatcgccgacctgtgggtggtggtgaccatccccgtctgg
gtggtcagcctcgtgcagcataaccagtggcccatgggggagctcacgtgcaagatcacc
cacctcatcttctccatcaacctgttcggcagcatcttcttcctcacgtgcatgagcgtg
gaccgctacctctccgtcacccgcttcgccagcacctcgagccgcaggaagaaggcggtc
cgccgcgccgtctgcgtgctggtgtggctgctggccttctgcgtgtccctgcccgacacc
tactacctgaagaccgtcacgtcggcgtccaacaacgagacctactgccgctccttctac
cccgagcacagcgtcaaggagtggctcatcagcatggagctggtctctgtggtcctgggc
ttcgccatccccttctgcgtcatcgccgtcttctactgcctgctggcccgcgccctcgcc
gcgtccagcgaccaggagaagcagagcagccgcagaatcatcttctcgtacgtggtggtc
ttcctcgtgtgctggctcccctaccacgtggtggtgctcctggacatcttctccatcctc
cactacatccccttcacctgccagctggagaacttcctcttcacggctctgcacgtcacg
cagtgcctgtcgctggtgcactgctgcgtcaaccccgtgctctacagcttcatcagccgc
aactacaggtacgagctgatgaaggccttcatcttcaagtactcggccaagacagggctc
accaagctcatcgacgcctccagggtgtcggaaacagagtactccgccctggagcagaac
accaagtga

KEGG   Ursus arctos horribilis: 113263416
Entry
113263416         CDS       T05909                                 

Gene name
CXCR4
Definition
(RefSeq) C-X-C chemokine receptor type 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
uah  Ursus arctos horribilis
Pathway
uah04020  Calcium signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04144  Endocytosis
uah04360  Axon guidance
uah04670  Leukocyte transendothelial migration
uah04672  Intestinal immune network for IgA production
uah04810  Regulation of actin cytoskeleton
uah05163  Human cytomegalovirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    113263416 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113263416 (CXCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113263416 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113263416 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113263416 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    113263416 (CXCR4)
   04672 Intestinal immune network for IgA production
    113263416 (CXCR4)
   04062 Chemokine signaling pathway
    113263416 (CXCR4)
  09158 Development and regeneration
   04360 Axon guidance
    113263416 (CXCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113263416 (CXCR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113263416 (CXCR4)
   05163 Human cytomegalovirus infection
    113263416 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113263416 (CXCR4)
   04050 Cytokine receptors [BR:uah04050]
    113263416 (CXCR4)
   04090 CD molecules [BR:uah04090]
    113263416 (CXCR4)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    113263416 (CXCR4)
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CXC Chemokine
   113263416 (CXCR4)
CD molecules [BR:uah04090]
 Proteins
  113263416 (CXCR4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx DUF4538
Other DBs
NCBI-GeneID: 113263416
NCBI-ProteinID: XP_026365856
UniProt: A0A3Q7VXX9
LinkDB
Position
Unknown
AA seq 353 aa
MDAFRIYPSDNYTEDDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLV
ILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGKFLCKAVHVIYTVN
LYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVRE
ADGRYICDRFYPNDSWLVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGYQKRKALK
TTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFESTVHKWISITEALAFFHCCLNP
ILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggacgcgttccgtatatacccttcagataactacacagaagatgacttgggctcaggc
gactatgactccatgaaggaaccctgcttccgggaggaaaatgcccatttcaaccgtatc
tttctgcccacggtctactccatcatcttcttgacgggcatagtgggcaatggattggtc
atcctggtcatgggttaccagaagaaactgagaagcatgacagacaagtatagactacac
ctgtctgtggcagacctcctctttgtcctcacgcttcccttctgggcagttgatgctgtg
gccaactggtactttggaaagttcctgtgcaaggcagtccatgtcatctatacagtcaac
ctctatagcagtgtccttatcctggccttcatcagtctggaccggtacttggctattgtc
catgccaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtctatgttggc
gtctggatacctgctctcctgttgaccattcctgatttcatctttgccaatgtcagggag
gcagatgggaggtatatctgtgaccgcttctatcccaatgactcgtggttggtggtgttc
cagtttcagcacatcatggttggccttatcctgccaggcattgtcatcctgtcctgctac
tgcattatcatctccaagctgtcccactctaagggctaccagaagcgcaaggccctcaag
accacagttatcctcatcctggctttcttcgcctgctggctgccctactacattgggatc
agcatcgattccttcatcctcctggaaatcatcaagcaaggatgtgagtttgagagcact
gtgcacaagtggatttccatcactgaggccctggcctttttccactgttgcctgaacccc
atcctctatgccttcctcggagccaaatttaaaacctctgcccaacatgcactcacctct
gtgagcagagggtccagcctcaagatcctttccaaagggaagcggggaggacattcttct
gtttcaaccgaatccgagtcttcaagttttcattccagctaa

DBGET integrated database retrieval system