KEGG   Ursus arctos horribilis: 113250342
Entry
113250342         CDS       T05909                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2 isoform X1
  KO
K03259  translation initiation factor 4E
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah03013  RNA transport
uah04066  HIF-1 signaling pathway
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04211  Longevity regulating pathway
uah04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113250342 (EIF4E2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    113250342 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    113250342 (EIF4E2)
   04150 mTOR signaling pathway
    113250342 (EIF4E2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113250342 (EIF4E2)
  09149 Aging
   04211 Longevity regulating pathway
    113250342 (EIF4E2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113250342 (EIF4E2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:uah03019]
    113250342 (EIF4E2)
   03012 Translation factors [BR:uah03012]
    113250342 (EIF4E2)
Messenger RNA biogenesis [BR:uah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     113250342 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     113250342 (EIF4E2)
Translation factors [BR:uah03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    113250342 (EIF4E2)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 113250342
NCBI-ProteinID: XP_026347479
UniProt: A0A3Q7VY76
LinkDB
Position
Unknown
AA seq 245 aa
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQGSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaagagtcagggc
agcagtaagaggaaggctgttgttcctggaccagcagaacatcccctgcagtacaactac
accttctggtactcccggagaacccctggccgtcccaccagttcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttatagccac
atggtacgtcccggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aaacctatgtgggaggacgatgcaaataaaaatggtggcaaatggattattcggctgcgg
aagggcttggcatcccgttgctgggagaatcttatcctggccatgttgggggaacagttc
atggttggggaggagatctgtggggctgtggtctctgtccggtttcaggaggacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgaatccgggatacgctt
cggcgagtgcttaacctacctcccaacaccattatggagtacaaaacccacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcaaaacctctggaagccg
cggttgaatgtgccatga

KEGG   Ursus arctos horribilis: 113263123
Entry
113263123         CDS       T05909                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah03013  RNA transport
uah04066  HIF-1 signaling pathway
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04211  Longevity regulating pathway
uah04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113263123 (EIF4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    113263123 (EIF4E)
   04151 PI3K-Akt signaling pathway
    113263123 (EIF4E)
   04150 mTOR signaling pathway
    113263123 (EIF4E)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113263123 (EIF4E)
  09149 Aging
   04211 Longevity regulating pathway
    113263123 (EIF4E)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113263123 (EIF4E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:uah03019]
    113263123 (EIF4E)
   03012 Translation factors [BR:uah03012]
    113263123 (EIF4E)
Messenger RNA biogenesis [BR:uah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     113263123 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     113263123 (EIF4E)
Translation factors [BR:uah03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    113263123 (EIF4E)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 113263123
NCBI-ProteinID: XP_026365466
UniProt: A0A3Q7VWN7
LinkDB
Position
Unknown
AA seq 217 aa
MATVEPETTPTPNPPPTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctactcctaatcccccgcctacagaagaagag
aaaacagaatctaatcaggaggttgctaacccagaacactatattaaacatcctttacag
aacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cggctgatctctaagtttgatactgttgaagacttttgggctctgtacaaccacatccag
ttgtctagtaacttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgaaaaaaacaaacgaggaggacgatggctaattacattgaacaagcag
cagagacgaagtgacctggatcgcttttggctagagacactgctgtgccttattggagaa
tcttttgatgactacagtgatgatgtatgtggagccgttgttaatgttagagctaaaggt
gataagatagcaatatggactactgaatgtgaaaacagagaggctgttacacatataggg
agggtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

KEGG   Ursus arctos horribilis: 113263893
Entry
113263893         CDS       T05909                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 1B
  KO
K03259  translation initiation factor 4E
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah03013  RNA transport
uah04066  HIF-1 signaling pathway
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04211  Longevity regulating pathway
uah04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113263893 (EIF4E1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    113263893 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    113263893 (EIF4E1B)
   04150 mTOR signaling pathway
    113263893 (EIF4E1B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113263893 (EIF4E1B)
  09149 Aging
   04211 Longevity regulating pathway
    113263893 (EIF4E1B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113263893 (EIF4E1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:uah03019]
    113263893 (EIF4E1B)
   03012 Translation factors [BR:uah03012]
    113263893 (EIF4E1B)
Messenger RNA biogenesis [BR:uah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     113263893 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     113263893 (EIF4E1B)
Translation factors [BR:uah03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    113263893 (EIF4E1B)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 113263893
NCBI-ProteinID: XP_026366454
UniProt: A0A3Q7XJ77
LinkDB
Position
Unknown
AA seq 266 aa
MAAAAPAIISMQKAGGEEVGVAHVQISEAEGRIQKWEEKEEKKDEKEEAAGSVLMAEGAL
NSPGALLSQRRKARDGCPQEVKLELHPLLNRWALWFFKNDRSRAWQDNLHLVTKFDTVED
FWAMYGHIQLASKLSSGCDYALFKDGIEPMWEDSRNKRGGRWLVSLAKQQRHSELDRLWL
ETLLCLIGESFEEHSREVCGAVINIRTKGDKIALWTREAENQADVLHIGQVYKERLGLST
KIVIGYQAHADTATKSNSLAKNKFVV
NT seq 801 nt   +upstreamnt  +downstreamnt
atggctgctgcagctccagccatcatatctatgcagaaagcaggaggggaggaagtagga
gttgctcacgtccaaatcagtgaggctgagggtagaatccaaaagtgggaggagaaagag
gagaaaaaggatgagaaagaggaggcagcagggtcagtgttgatggcagagggggctctg
aattcccctggggccctgctgtcccagaggaggaaagcccgggatgggtgcccccaggag
gtcaagttggagttacacccgctgctgaacaggtgggctctgtggtttttcaagaatgac
cgcagccgtgcctggcaggacaacctgcatctggtcaccaagtttgataccgtggaggac
ttctgggcgatgtacggtcacatccagctggccagtaagctctcttccggctgtgactac
gccctgttcaaggatggcattgagcccatgtgggaagacagcaggaataagaggggtggc
cgctggctggtcagtctcgccaagcagcagcgccacagcgagctggaccgcctgtggctg
gagaccctgctgtgtctgattggggagagctttgaggagcatagccgggaggtgtgtggg
gcagtcatcaacatccgaaccaagggggacaagatagccttgtggacgagggaggcagag
aaccaggcggacgtgctgcacattgggcaggtctacaaagagcgcctgggcctctccacg
aagatagtcattgggtaccaggcccatgcagacacggccaccaagagcaactccctagcc
aagaataagtttgtggtgtga

DBGET integrated database retrieval system