KEGG   Ursus arctos horribilis: 113250472
Entry
113250472         CDS       T05909                                 

Gene name
CXCR2
Definition
(RefSeq) C-X-C chemokine receptor type 2
  KO
K05050  C-X-C chemokine receptor type 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04072  Phospholipase D signaling pathway
uah04144  Endocytosis
uah05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    113250472 (CXCR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113250472 (CXCR2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113250472 (CXCR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113250472 (CXCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113250472 (CXCR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113250472 (CXCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113250472 (CXCR2)
   04050 Cytokine receptors [BR:uah04050]
    113250472 (CXCR2)
   04090 CD molecules [BR:uah04090]
    113250472 (CXCR2)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    113250472 (CXCR2)
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CXC Chemokine
   113250472 (CXCR2)
CD molecules [BR:uah04090]
 Proteins
  113250472 (CXCR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 113250472
NCBI-ProteinID: XP_026347752
UniProt: A0A3Q7VF98
LinkDB
Position
Unknown
AA seq 356 aa
MEDIDWESYSLEDLFGENYSYSTDLPFIPANSAPCRPESLEINKYVVVVIYALVFILNML
GNSLVILVVLHSRLSQSVTDVYLLNLAIADLLFALTLPIWAASKAKGWIFGTALCKVVSL
LKEVNFYSSILLLACISMDRYLAIVHATRTLTQKRHWVKFICLGIWALSLILSLPIFVFR
RAINPPYSSPVCYEDMGANTTKLRIVMRALPQTFGFLLPLAVMLFCYGLTLRTLFEAHMG
QKHRAMRVIFAVVLVFLLCWLPYNLVLVADTLMRLRVIQETCERRNDIGRALDATEILGF
LHSCLNPFIYAFIGQKFRHGLLKIMAFHGLISKEYLSKDGRPSFVGSSSANTSTTF
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggaagatattgactgggagagttatagcttggaagatctcttcggtgaaaattacagt
tacagcacggacctgccctttattccagcaaactctgccccatgcaggccagaatctctg
gaaatcaacaagtatgtggtggtagtcatctatgccctggtcttcattctcaatatgctg
ggaaactccctcgtgatcctggtggtcttacacagtcggctcagccagtctgtcaccgac
gtctacctgctgaacctggccatagctgacctgctcttcgccctgaccttgcctatctgg
gctgcctccaaggcaaagggctggatctttggcacggccctgtgcaaggtggtctcgctc
ctgaaggaagtcaatttctatagcagcatcctgctgctggcctgcatcagcatggaccgc
tacctggccattgtccatgccacacgcacgctgacccagaagcggcactgggtcaagttc
atatgcttaggcatctgggctctgtccctgatcctgtccctgcccatcttcgtcttccgc
agggccatcaatcctccctactccagcccggtctgctacgaggacatgggagccaacacg
acgaaactgcggatagtgatgcgggccctgccccagacctttggcttcctcctgcccctg
gcggtcatgctgttctgctacggactcaccctgcgcacgctgttcgaggcccacatgggg
cagaagcaccgggccatgcgggtcatcttcgccgtcgtgctcgtcttcctgctctgctgg
ctgccctacaacctggtgctggtggcagacaccctcatgaggctccgggtgatccaggag
acctgtgagcgccgcaacgacattggccgggccctggacgccactgagattctgggcttc
ctccacagctgcctcaatcccttcatctacgccttcatcggccagaagttccgccatgga
ctcctcaagatcatggccttccatgggctcatcagcaaggagtacttgtccaaggacggc
aggccttcctttgttggctcttcttcagccaacacttccacgaccttctga

DBGET integrated database retrieval system