KEGG   Ursus arctos horribilis: 113250557
Entry
113250557         CDS       T05909                                 

Gene name
CTLA4
Definition
(RefSeq) cytotoxic T-lymphocyte protein 4 isoform X1
  KO
K06538  cytotoxic T-lymphocyte-associated protein 4
Organism
uah  Ursus arctos horribilis
Pathway
uah04514  Cell adhesion molecules (CAMs)
uah04660  T cell receptor signaling pathway
uah05320  Autoimmune thyroid disease
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113250557 (CTLA4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    113250557 (CTLA4)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113250557 (CTLA4)
   05320 Autoimmune thyroid disease
    113250557 (CTLA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:uah04090]
    113250557 (CTLA4)
CD molecules [BR:uah04090]
 Proteins
  113250557 (CTLA4)
SSDB
Motif
Pfam: V-set V-set_2 Ig_3 I-set
Other DBs
NCBI-GeneID: 113250557
NCBI-ProteinID: XP_026347921
UniProt: A0A3Q7UHN9
LinkDB
Position
Unknown
AA seq 223 aa
MACFGFRRHGAQLDLAPRTWPCTALFSLLFIPVFSKGMHVAQPAVVLASSRGVASFVCEY
GSSGNAAEVRVTVLRRAGSQVTEVCAATYTVEDELAFLDDSTCAGTSSGNKVNLTIQGLR
AMDTGLYICKVELMYPPPYYVGMGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL
ITAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcttgctttggattccggaggcatggggctcagctggacctggctcctaggacctgg
ccctgcaccgctctgttttctcttctatttatcccagtcttctccaaagggatgcacgtg
gcccagcctgcggtggttctggccagcagccgcggtgtcgccagctttgtgtgtgagtat
gggtcttcaggcaatgccgccgaggtccgggtgacggtgctgcggcgggccggcagccag
gtgactgaagtctgcgccgcgacatatacagtggaggatgagttggccttcctagatgat
tccacctgcgctggcacctccagtggaaacaaagtgaacctcaccatccaagggttgagg
gccatggacacggggctctatatctgcaaggtggagctcatgtacccgccaccctactat
gtaggcatgggcaatggaacccagatttatgttatcgaccctgaaccttgcccggattct
gacttcctcctctggatccttgccgcagtcagttcggggctgtttttttacagcttcctt
atcacagctgtttctctgagcaaaatgctaaagaaaagaagccctcttactacaggggtc
tatgtgaaaatgcccccaacagagccagaatgtgaaaagcaatttcagccttattttatt
cccatcaattga

DBGET integrated database retrieval system