KEGG   Ursus arctos horribilis: 113250560
Entry
113250560         CDS       T05909                                 

Gene name
CD28
Definition
(RefSeq) T-cell-specific surface glycoprotein CD28
  KO
K06470  CD28 antigen
Organism
uah  Ursus arctos horribilis
Pathway
uah04514  Cell adhesion molecules (CAMs)
uah04660  T cell receptor signaling pathway
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05162  Measles
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05320  Autoimmune thyroid disease
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113250560 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    113250560 (CD28)
   04672 Intestinal immune network for IgA production
    113250560 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113250560 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    113250560 (CD28)
   05323 Rheumatoid arthritis
    113250560 (CD28)
   05320 Autoimmune thyroid disease
    113250560 (CD28)
   05330 Allograft rejection
    113250560 (CD28)
   05332 Graft-versus-host disease
    113250560 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113250560 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113250560 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    113250560 (CD28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:uah04090]
    113250560 (CD28)
CD molecules [BR:uah04090]
 Proteins
  113250560 (CD28)
SSDB
Motif
Pfam: V-set_2 V-set
Other DBs
NCBI-GeneID: 113250560
NCBI-ProteinID: XP_026347923
UniProt: A0A3Q7VFR8
LinkDB
Position
Unknown
AA seq 276 aa
MPCGLSPLIMCPEGKKLVGAVDDETLGLWQVRLQFPSHFGLLGEEGLEPWPTISTMILRL
LLALNFFPSIQVTENKILVKQLPRLVVYDNEVNLSCKYTHNLFSKEFRASLYKGVDSAVE
VCVVSGNYSHQPQFYSSTGFDCDGKMGNETVTFYLRKLFVNQTDIYFCKIEVMYPPPYID
NEKSNGTIIHVKEKHHCPAQPSPESSKPFWALVVVGGVLVFYSLLVTVALCACWMKNKRS
RILQSDYMNMTPRRPGPTRRHYQPYAPARDFAAYRS
NT seq 831 nt   +upstreamnt  +downstreamnt
atgccttgtggtttgagtcccttgatcatgtgccctgagggaaagaagttggtgggagct
gtggatgacgagacgctagggctgtggcaggtgcgtcttcagttcccctcacactttggg
ctcctcggggaggaggggctggagccctggcccaccattagcacaatgatcctcaggctg
cttctggctctcaacttcttcccctcgattcaagtaacagaaaacaagattctggtgaag
cagttgcccaggcttgtggtgtacgacaacgaggtcaacctgagctgcaagtatacccac
aacctcttctcaaaggagttccgggcatccctttataagggagtagatagtgctgtggaa
gtctgtgttgtgagtggaaattactcccatcagcctcagttctattcaagtacaggattc
gactgtgatgggaaaatgggcaacgaaacagtgacattctacctccggaagttgtttgtt
aaccaaacggatatctacttctgcaaaatcgaggtcatgtatccacctccttacatagac
aatgagaagagcaatgggaccattatccatgtgaaagagaaacatcattgtccagcgcag
ccgtctcctgaatcttctaagccattttgggcactggtggtggttggtggagtcctagtt
ttctatagcttgctagtaacagtggctctttgtgcctgctggatgaagaataagaggagc
aggatccttcagagtgactacatgaatatgaccccccggaggccggggcccacccgaagg
cactaccaaccctatgccccagcacgcgactttgcggcataccgctcctga

DBGET integrated database retrieval system