KEGG   Ursus arctos horribilis: 113250592
Entry
113250592         CDS       T05909                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8 isoform X1
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
uah  Ursus arctos horribilis
Pathway
uah01524  Platinum drug resistance
uah04115  p53 signaling pathway
uah04210  Apoptosis
uah04215  Apoptosis - multiple species
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04668  TNF signaling pathway
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah05010  Alzheimer disease
uah05016  Huntington disease
uah05132  Salmonella infection
uah05134  Legionellosis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    113250592 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113250592 (CASP8)
   04215 Apoptosis - multiple species
    113250592 (CASP8)
   04217 Necroptosis
    113250592 (CASP8)
   04115 p53 signaling pathway
    113250592 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113250592 (CASP8)
   04621 NOD-like receptor signaling pathway
    113250592 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    113250592 (CASP8)
   04625 C-type lectin receptor signaling pathway
    113250592 (CASP8)
   04657 IL-17 signaling pathway
    113250592 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113250592 (CASP8)
   05203 Viral carcinogenesis
    113250592 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113250592 (CASP8)
   05016 Huntington disease
    113250592 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113250592 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113250592 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113250592 (CASP8)
   05134 Legionellosis
    113250592 (CASP8)
   05152 Tuberculosis
    113250592 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113250592 (CASP8)
   05162 Measles
    113250592 (CASP8)
   05164 Influenza A
    113250592 (CASP8)
   05161 Hepatitis B
    113250592 (CASP8)
   05160 Hepatitis C
    113250592 (CASP8)
   05168 Herpes simplex virus 1 infection
    113250592 (CASP8)
   05163 Human cytomegalovirus infection
    113250592 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113250592 (CASP8)
   05169 Epstein-Barr virus infection
    113250592 (CASP8)
   05165 Human papillomavirus infection
    113250592 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113250592 (CASP8)
   05142 Chagas disease (American trypanosomiasis)
    113250592 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    113250592 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:uah01002]
    113250592 (CASP8)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     113250592 (CASP8)
Peptidases and inhibitors [BR:uah01002]
 Cysteine peptidases
  Family C14: caspase family
   113250592 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 113250592
NCBI-ProteinID: XP_026347970
UniProt: A0A3Q7V790
LinkDB
Position
Unknown
AA seq 486 aa
MNFSKCLYNIGEQLDSDELASLKFLSMDYIPQKKQEPIKDPLMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLVTYLDTSKEEMEQELQIPGRAQISAYRVMLFQISEDVSKLELRSF
KFFLSQEISRCKLHDDLNLFDIFIEMEKRVILGERNLDTLKRICDQINKSLLKKITDYEE
LSREQTLSPQRSLDEISNDMSQLLVGEESLRVPPMSDSPGEQDCEPETSDKVYRMESKPR
GYCLIFNNYDFSIARKEVPKLQSIKDRNGTDLDADALCQTFSELHFEIVPFKDCTAKKIC
EVLKSYQSMDHSSRDCFICCILSHGDKGIIYGSDGQEVPIYELTSYFTGSKCPSLAGKPK
IFFIQACQGDNYQKGIAVETDSEQKEAYLEMDSSYQKRYIPEDADFLLGMATVNNCVSYR
NPMEGTWYIQSLCQSLRERCPRGEDILTILTEVNFEVSNKDDRKNMGKQMPQPTFTLRKK
LFFPLN
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaatttcagcaaatgcctctataatattggagaacagctggacagtgatgagctggcc
tccctcaagttcctgagcatggactacatcccacagaagaagcaggaacccatcaaggat
cccttgatgttattccagagactccaggaaaagagaatgttggaggaaagcaacctgtcc
ttcttgaaggagctgcttttccgaattaacagactggacctgctggttacctacctggac
accagcaaggaggagatggagcaggagcttcaaataccaggcagagcccagatctctgcc
tacagggtcatgctttttcagatttcagaagatgtaagcaaattggaattgaggtccttt
aagttttttttgagccaggagatctccagatgtaaactgcacgatgacttgaacttgttt
gatattttcatagagatggagaagagggtcatcctcggggaaagaaatctggataccctg
aaaagaatctgtgaccaaattaacaagagcctgctgaagaaaatcacggattatgaagaa
ttaagcagagagcaaacactgagccctcaaagaagtctagatgaaatttcaaatgatatg
tctcagttgcttgtaggggaggaatccctgagggtaccgccaatgtcggactctccagga
gaacaggactgtgaaccagagacatcggacaaagtttaccgaatggaaagcaaacctcga
ggatattgtttgatctttaacaattacgactttagcatagcacggaaggaagtgcccaaa
cttcagagcattaaggataggaatggaacagacttggatgcagatgctttgtgtcagacc
tttagtgagcttcattttgagatcgtgcctttcaaagactgtacagccaagaaaatctgt
gaggttctgaaatcctaccaaagcatggaccactctagcagggattgcttcatctgctgc
atcctctcccatggagacaagggcatcatctatggctctgatgggcaagaagtccccatc
tatgagctgacttcttacttcactggttcaaagtgcccttcccttgcaggcaagcccaaa
atcttttttattcaggcttgtcaaggggataactaccagaaaggtatagctgttgagact
gactctgaacagaaggaagcctatttagaaatggactcatcctatcagaagagatatatc
ccagaagatgctgactttctgctggggatggccactgtgaataattgtgtttcctaccga
aaccccatggaggggacctggtatatccagtcactttgccagagcctgagagaaagatgt
cctaggggcgaagatattctcaccatccttaccgaggtgaactttgaagtgagcaataag
gatgacaggaaaaacatggggaaacaaatgccacaacctactttcacactgaggaaaaaa
ctctttttccctcttaattga

DBGET integrated database retrieval system