KEGG   Ursus arctos horribilis: 113250605
Entry
113250605         CDS       T05909                                 

Definition
(RefSeq) aldehyde oxidase 2 isoform X1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah00280  Valine, leucine and isoleucine degradation
uah00350  Tyrosine metabolism
uah00380  Tryptophan metabolism
uah00750  Vitamin B6 metabolism
uah00760  Nicotinate and nicotinamide metabolism
uah00830  Retinol metabolism
uah00982  Drug metabolism - cytochrome P450
uah01100  Metabolic pathways
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113250605
   00350 Tyrosine metabolism
    113250605
   00380 Tryptophan metabolism
    113250605
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    113250605
   00760 Nicotinate and nicotinamide metabolism
    113250605
   00830 Retinol metabolism
    113250605
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    113250605
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113250605
Enzymes [BR:uah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     113250605
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 113250605
NCBI-ProteinID: XP_026348006
UniProt: A0A3Q7UHV4
LinkDB
Position
Unknown
AA seq 1343 aa
MPCPPKSDDLVFFVNGRKVIERNVDPEVTLLSFLRKNLRLTGTKYACGRGGCGACTVMVS
KRDPLSAKIRHFSITACLVPICSLYGAAVTTVEGVGSINTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLLEALGGNLCRCTGYRPILASGRTFCVESNGCQQKGTG
KCCLDPGGNDSSSLLRESDICTELFAEDEFQPLDPTQELIFPPELLRMAEKPEKQTLIFR
GEMVTWISPGTLKDLLELKAKHPEAPLISGNTSLGPAMKSQGHFYPILLSPARISELSMV
SKTSDGLTIGAGCSLAQVKDILAERVSELPEEKTQTYRALLKHLRSLAGQQIRNMASLGG
HIISRHCYSDLNPILAVGNATLNLISEEGTRQIPLNEHFLAGLASVDLKPEEILESVYIP
HSQKWEFVSAFRQAQCQQNALADVNAGMRVVLKEGTDTIKDLSIAYGGVGAATVSAQKSC
QQLVGRPWNELMLEEACRLLLEEVSLPGWAPGGKVEFKRTLVVSFFFKFYLEVLQELKKL
VKFMPDSHHYPEISDQFLSALEDFPITGSQGVQRYQRVDSHQSLQDPVGRPIMHLSGLKH
ATGEAIFCDDIPMVDRELFMVLVTSTRAHAKIISVDLSEALDLPGVIDVITAEDIPGTNG
TEDDKLMAVDEVLCVGHIICAVVAETELQAKSATEKIKITYEDLEPVIITINDAIKHNSF
LCPEKKLEQGNVEEAFEKVDQIVEGEVHVGGQEHFYMETQRVLVIPKAEDKELDIYVSTQ
DPAHVQKTVSSTLNIPINRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAIKTGHPIRLVL
DRKDDMLITGGRHPLFGKYKVGFMNNGRIKALDIECFVNGGCMLDDSELVTEFLILKLEN
AYKIRNLRFRGRACMTNLPSNTAFRGFGFPQGTLITESCITAVAAKCGLLPEKIREKNMY
KTVDKTIYKQAFSPETLIRCWNECLDKSSFHSRRMQVEEFNKKNYWKKKGMAIIPMKFSV
GFAATSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELNIPMSSLHICETS
TATVPNTIATAASIGSDVNGRAVQNACQILLKRLEPIIKKNPEGTWEDWIEAAFEQRISL
SATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEVDCLTGAHKKIRTDIVMDACCSLN
PAIDIGQVEGSFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPTIADVPEEFNVSLLPSS
QTPPTIYSSKGLGESGMFLGSSVFFAITDAVAAARRERDTVEDFTVRSPATPEWVRMACA
DRFTEMIPRDDPKTFRPWSIPIA
NT seq 4032 nt   +upstreamnt  +downstreamnt
atgccttgcccaccgaaatcggatgacttggttttctttgtgaatgggagaaaggtgata
gagaggaatgtggacccagaagtcactctgctgagcttcctacgaaagaacttacgcctc
acaggaaccaagtacgcctgtggaagaggaggctgcggcgcgtgcacggtgatggtgtct
aagcgtgacccgctgtccgcgaagataagacacttctccattactgcatgcctggtgccc
atctgctctctgtatggggctgctgtcaccactgtggaaggtgttggaagtatcaacacc
aggcttcaccctgtgcaggagaggattgccaagagccacggcacccagtgtgggttctgc
acccctgggatggtgatgtccatgtacacgctccttaggaaccacccgcagccctcggag
gagcaactcctggaagccctgggaggtaatctatgccgctgcacggggtatcggccaatt
ctcgcaagcggaaggaccttctgtgtggagtcaaatggctgtcaacagaaaggaacagga
aaatgctgcttggatcccggaggaaatgattcttcttcactcctcagggaaagtgacatt
tgcacagagttatttgcggaagacgagttccagcccttggaccctacccaggagcttata
tttcccccagaactcctgagaatggcagagaagccagaaaaacaaaccctgatttttcgt
ggagagatggttacttggatctcccctggcaccctcaaggatctcctggagctgaaagcc
aaacatcctgaagcccctctcatctcaggcaacacctcactgggtcctgcaatgaaatct
caaggacatttttacccaattctcctctctcctgctaggatttctgagctcagtatggta
tccaaaacaagtgatggactgacaataggtgctggctgcagtctggcccaagtgaaagac
attttggctgagcgagtttccgagcttccagaggagaaaactcagacataccgagccctc
ctgaagcacctgaggagtctggcgggccagcagatccggaatatggcatccttaggggga
catattataagccggcactgctattcggatctgaatccaattttggctgtgggcaacgct
accctcaatctgatatcagaagaaggtacacggcagattcctctaaacgaacattttctt
gctgggttggcaagtgtagaccttaagccagaggaaattttggaatctgtgtacatccct
cactctcaaaagtgggaatttgtgtcagccttccgacaggctcagtgccaacaaaatgcc
ttggccgacgtgaacgctggcatgagagtcgtcctcaaggaaggcacagacaccatcaag
gacctgagcatcgcctatggaggggttggggccgccacagtcagtgcacagaaatcctgc
cagcagctcgtggggaggccctggaatgagctgatgctggaggaagcttgcaggctgctt
ctggaagaagtctccctcccaggctgggctccaggggggaaagtggaattcaagaggact
ctggtggtcagtttcttcttcaaattctacctagaagttctgcaggaactgaagaagcta
gtaaagtttatgcctgacagccatcattatcctgaaatttcagaccaattcctaagtgct
ctagaagacttccccatcacaggatcccagggagtccaaaggtaccagcgtgtggattct
caccaatccctccaagatccagttgggcgccccatcatgcacctatcaggtcttaaacat
gctacaggtgaagccatattttgtgatgacattccaatggtggatagagaacttttcatg
gttttggtgaccagtaccagagcccatgcaaaaatcatatcagttgatttgtctgaggcc
cttgacctaccaggggtgattgatgtgataacagctgaggacattccaggcaccaatggg
actgaggatgacaagttgatggctgtagatgaggtgctttgcgtgggccacatcatctgt
gctgtggttgcagagacagaattacaggcaaagagtgcaactgaaaagataaagatcact
tatgaagatctggagccagtaatcatcaccatcaacgatgccataaagcacaactcattc
ctatgccctgaaaaaaaacttgaacaaggaaacgttgaggaggcatttgaaaaagtcgat
caaattgttgaaggagaggtccacgttggaggacaggaacatttttacatggaaacacaa
agagtgcttgttattccgaaggcagaggacaaagaactggacatttatgtgtcaacacag
gatccagcccacgtacagaaaacggtgtcctctactttaaacatccccatcaacaggatc
acctgtcatgtcaaacgggtgggtggaggttttggcgggaaagtaggaagaccagctgta
tttggagctattgcagctgtgggcgctatcaaaactggtcatcctattcgtcttgttctt
gatcgcaaagatgatatgttaataactgggggaagacacccactatttggaaaatataaa
gtgggattcatgaacaacgggcgaatcaaagctctggacatcgagtgcttcgtcaacgga
ggatgcatgctggatgactctgagctggtaacagaatttcttatattaaagctagaaaat
gcatataaaatccgcaacctcaggttccggggccgtgcatgcatgacaaatctaccatct
aacacagcctttcgcggatttggcttcccacaaggaaccctgataacagaatcttgcatc
acagctgtggcagccaaatgtggccttctgccagaaaagattagggagaaaaacatgtac
aaaacggttgataaaaccatctacaaacaagcgttcagccctgagaccctgataagatgt
tggaatgagtgtttggacaagtcttcctttcacagcagaagaatgcaagtggaagagttt
aacaagaagaattattggaagaagaagggcatggcaatcatccccatgaagttctcagtc
ggctttgctgcaacaagctatcaccaggcagctgccctcgttcatatctacacagatggc
tctgtattggtcacacatggaggcaacgaactgggacaaggtattcacaccaaaatgctg
caggtggccagccgtgaattaaacatacccatgtcttctctgcacatctgtgaaacaagt
acggccacagtgcctaatacaattgccacggcggcttccattggttcggatgtcaacggc
agagccgtgcagaacgcttgtcagatccttctgaaacgcctcgagcccatcattaagaaa
aatccagaaggtacatgggaagactggatagaagctgctttcgaacaaagaatcagtctt
tcagccactggatacttcaggggctacaaggctttcatggactgggagaagggagaagga
gaccctttcccgtactatgtctatggagcagcctgttcagaggttgaagttgactgcctg
acgggcgctcacaagaaaatcagaacagacattgtcatggatgcatgttgcagcctaaat
cccgctattgatattgggcaggttgaaggttcctttattcagggaatgggcctttatacc
actgaagagctgaaatattccccagaaggtgttctgtactctcgaggcccagacgagtac
aaaattccaaccatcgctgacgtcccagaggagttcaatgtctccctgttgccatcctca
caaaccccaccaaccatctattcatccaagggcctgggggagtctgggatgttcttgggc
tcgtctgtgttcttcgccatcactgatgctgtggccgcagcacgcagggaaagagacacc
gtggaggacttcacagtgaggagcccagcaacgccagaatgggttcgaatggcctgtgcg
gatcggttcacagagatgatcccaagagatgacccgaagacatttagaccttggtctatc
cctatagcataa

KEGG   Ursus arctos horribilis: 113250606
Entry
113250606         CDS       T05909                                 

Definition
(RefSeq) aldehyde oxidase isoform X1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah00280  Valine, leucine and isoleucine degradation
uah00350  Tyrosine metabolism
uah00380  Tryptophan metabolism
uah00750  Vitamin B6 metabolism
uah00760  Nicotinate and nicotinamide metabolism
uah00830  Retinol metabolism
uah00982  Drug metabolism - cytochrome P450
uah01100  Metabolic pathways
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113250606
   00350 Tyrosine metabolism
    113250606
   00380 Tryptophan metabolism
    113250606
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    113250606
   00760 Nicotinate and nicotinamide metabolism
    113250606
   00830 Retinol metabolism
    113250606
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    113250606
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113250606
Enzymes [BR:uah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     113250606
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 ACP_syn_III_C
Other DBs
NCBI-GeneID: 113250606
NCBI-ProteinID: XP_026348009
UniProt: A0A3Q7VZQ4
LinkDB
Position
Unknown
AA seq 1338 aa
MDRAVELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGTGGCGACTVMISRYN
PTIKRISHHAANACLIPICSLYGAAVTTIEGIGSTKTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPSLEQLTDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSRENGVCY
LDQEINELPELEEVNKISLKLFSEEEFLPLDPTQELIFPPELMIMAEKQPQRTRIFGGDR
MTWISPTTLTALLEAKFKYPQAPVVMGNTSVGPEMKLKGVFHPVIISPDGIEELNFANCS
HNELTLGAGLSLTQVKYILGEVIQNLPEEKTRMYRALLKHLRTLAGSQIRNMASLGGHIV
SRHLDSDLNPLLAVGNCTLNLLSKKGKRQVPLNEEFLRRSPSADLKPEEILISVKIPHSR
KWEFVSGFRQAQRQQNALAVVNSGMRVFFGEGGDIIRELSISYGGVGPTTVCAKNSCRKL
IGRPWNEEMLDVACRLVLDEVTLPGSAPGGRVEFKRTLIVSFLFKFYLEVLQILKRMDPV
RSPGLADKYESALEDLHSGHHCSTLKYENVDSKNLPQDPIGQPIMHLSGIKHATGEAIYC
DDMPTVDQELFLSFVTSSRAHAKIVSIDLSEALSLPGVVDIVTEEHLRGVNSFCILSEPE
KLLRTEEVSCVGQLVCAVIAESEVQAKQAAKRVKVVYQDLQPLILTIEEAIQHNSFFEPE
RKLEYGNVDEAFKVVDHILEGEIHIGGQEHFYMETQSMLVVPKGEDQEIDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVKRVGGAFGGKTYKTGIMAAITAFAANKHGRAVRCILERGE
DMLITGGRHPYLGKYKAGFMNDGRILALDMQHYSNGGASLDESLLVIEMGLLKMENAYKF
PNLRCRAWACRTNLPSNTALRGFGFPQAGLITESCITEVAARCGLAPEKVRMINMYKEID
QTPYKQEINAKNLIQCWKECMDMSSYSLRKAAVEKFNSENYWKKKGLAVVPLKFPVGLGS
VAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSHELRMPISNIHLRGTSTETV
PNTNISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPQGTWKDWAQAAFDESISLSATG
YFRGYESNMSWETGEGHPFEYFVYGAACSEVEIDCLTGAHKNIRTDVVMDVGCSINPALD
IGQIEGAFIQGMGLYTIEELHYSPQGVLYTRGPNQYKIPAICDIPTELHISLLPPSQSSN
TLYSSKGLGESGIFLGCSMFFAIHDAVNAARQERGLFGPLKLNSPLTPEKIRMACEDKFT
KMIPKDKPGSYVPWNVPI
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggaccgggcggtggagctgctcttctacgtgaacggccgcaaggtgatagaaaaaaat
gttgatcctgaaacaatgctgttaccatatctgaggaagaagcttcgactcacaggcact
aagtatggctgtggaacgggaggctgtggtgcttgcacagtgatgatatcacgatataac
cccactatcaagaggataagccatcatgcagccaacgcctgtctgatccccatctgctct
ctgtatggggctgctgtcaccacaatagaaggcataggaagcaccaagaccaggattcat
cctgttcaggagaggatcgccaagtgtcatggcacgcagtgtgggttctgcacccctggg
atggtgatgtccatctacacattgctgaggaaccatccagaaccctctctggagcagcta
actgatgctcttggtggtaacctctgtcgttgcactggatataggcccataattgatgca
tgcaagactttctgtaaaacttctggctgctgtcaaagtagagaaaatggggtttgctat
ttggatcaagaaataaatgaattaccagaacttgaagaagtaaataagataagtctaaaa
ctcttctcagaagaggagtttctgccactggatccaactcaagaattgatatttcctcca
gagctaatgataatggctgagaaacaaccacaaaggactaggatttttggtggtgataga
atgacatggatttcaccaacgaccctgacggcacttctggaagcgaaattcaagtatcct
caggcccctgttgtcatggggaacacctctgtagggcctgaaatgaaattaaagggtgtc
tttcacccagttataatttctcctgatggaattgaagaactgaattttgcaaactgttca
cataatgagctgaccttaggtgctggcctcagcctgactcaggtgaagtacatcttgggt
gaagtaatccagaacctcccagaggagaagacacggatgtaccgtgctctcttgaagcat
ttgagaactctggctggatctcagatcaggaacatggcttctttagggggccatatcgtg
agcaggcacctagattcagatctgaatcccctcctggctgtgggcaactgtaccctcaac
ttgctatcaaaaaaaggaaaacgacaggttcctttaaatgaggagtttctcagaaggtcc
cccagcgcagatctgaagcctgaagagatcttgatctcagtgaaaataccccactcgagg
aagtgggaatttgtgtcaggcttccgacaagcccagcggcaacagaatgcactcgccgta
gtcaattcgggaatgagagtcttttttggagaagggggtgacatcatcagagagttatcc
atctcatacggaggcgttggcccaaccactgtctgtgccaagaattcctgccggaagctc
atcggaaggccctggaatgaggagatgctggacgtagcttgcaggctggttctggacgaa
gttacccttccaggctcagctccgggcgggagggtggagttcaagaggactctcatcgtc
agcttcctcttcaagttctacctagaagtgttgcagattctgaagaggatggaccctgtt
cgctctcctggccttgcagacaagtatgagagtgctttagaagatcttcattccggacat
cactgcagtacattaaagtacgagaatgtagactcaaagaaccttcctcaagacccaatt
ggccaacccatcatgcatctgtctggtattaagcatgccacgggtgaagccatctactgt
gacgacatgcctacagtggaccaggaacttttcttgtcctttgtgacaagttcaagagct
catgctaagattgtgtctattgatttgtcagaagctctcagcctgcctggtgtggtggac
attgtgactgaggaacatcttcgtggtgtcaactccttctgcattttaagcgaaccggag
aaacttctgaggacagaggaggtgtcctgtgtgggccagcttgtctgtgctgtgatcgca
gagtccgaggttcaggcaaagcaagcggccaagcgagtgaaggttgtctaccaagatttg
cagccactgatcctgacaattgaggaagccatacagcacaactccttcttcgaaccagag
aggaaactggaatatggaaatgtggatgaagcatttaaagtggttgatcacattttagaa
ggtgaaatacatataggaggtcaagaacatttttatatggaaacccaaagcatgcttgtt
gttcccaaaggagaggatcaagaaatcgatgtctatgtttctacacaatttcccaaatac
atacaggacatagttgcttcgaccttgaagctcccagctaacaaggtcatgtgtcacgta
aagcgtgttggtggggcttttggagggaagacctacaaaaccggcatcatggcagccatc
accgcatttgctgccaacaaacatggtcgtgcagtccgctgcattctggagagaggagaa
gacatgttaatcactggaggccgccatccttaccttgggaagtacaaagctgggttcatg
aatgatggcagaatcttggccctggatatgcagcattatagcaatggaggcgcctccctg
gatgagtcattacttgtgatagaaatgggacttctgaagatggaaaatgcttacaagttt
cccaacctgcgctgccgggcgtgggcgtgcagaaccaaccttccatccaacacagctctg
cgtggctttggctttcctcaggcagggctcatcactgagtcctgtatcaccgaagtggca
gccaggtgtggtttggcccctgagaaggtccgaatgataaacatgtacaaggaaattgat
caaacaccctacaaacaagagattaatgccaagaacctgattcagtgttggaaagaatgt
atggacatgtcttcctactccctgaggaaagcggctgtagaaaaattcaattcggagaat
tattggaagaaaaaagggctggctgtggtccccctgaagtttcctgttggtcttggctca
gtcgctgctggtcaggctgctgccttggttcacatttacctggatgggtctgtgctggtg
acgcatggtgggattgaaatgggtcagggcgtccacacgaaaatgattcaggtggttagt
catgaattaaggatgccgatatctaacatccacctgcgtgggacaagcacagaaactgtc
cctaacacaaacatctccggagggtccgtggtggcggatctcaacgggttggcagtaaag
gatgcttgtcagactcttctaaaacgccttgaacccatcatcagcaagaatcctcaaggc
acttggaaggattgggcacaagctgcttttgatgaaagcattagtctttcagctactgga
tacttcaggggctacgagtccaacatgagctgggagacaggcgaaggccatcctttcgaa
tattttgtgtatggagctgcctgttccgaggttgaaatagactgcctgacgggcgctcat
aagaacatcagaacagacgtggtcatggatgttggctgcagcataaatccagcccttgac
ataggccagatcgaaggtgcatttattcaaggcatgggactttatacaatagaggagctg
cattattctcctcagggtgtcctgtacactcgtggtccaaaccaatataaaatccctgcc
atctgtgacatccccaccgagctgcatatttctttattgcctccgtctcaaagctcaaat
accctgtattcatcgaagggtctaggagagtctgggatattcctgggatgttcaatgttt
tttgccattcatgatgcggtgaatgcagcacgacaggagagaggcctgtttggaccattg
aagctcaatagtcccctgaccccagagaagattagaatggcttgtgaagataagttcaca
aaaatgatcccaaaagacaaacctggatcctatgttccttggaatgtacccatatga

KEGG   Ursus arctos horribilis: 113250607
Entry
113250607         CDS       T05909                                 

Definition
(RefSeq) aldehyde oxidase 4-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah00280  Valine, leucine and isoleucine degradation
uah00350  Tyrosine metabolism
uah00380  Tryptophan metabolism
uah00750  Vitamin B6 metabolism
uah00760  Nicotinate and nicotinamide metabolism
uah00830  Retinol metabolism
uah00982  Drug metabolism - cytochrome P450
uah01100  Metabolic pathways
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113250607
   00350 Tyrosine metabolism
    113250607
   00380 Tryptophan metabolism
    113250607
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    113250607
   00760 Nicotinate and nicotinamide metabolism
    113250607
   00830 Retinol metabolism
    113250607
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    113250607
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113250607
Enzymes [BR:uah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     113250607
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Ald_Xan_dh_C Fer2_2 Fer2 DUF1409 DUF218
Other DBs
NCBI-GeneID: 113250607
NCBI-ProteinID: XP_026348012
UniProt: A0A3Q7WCF6
LinkDB
Position
Unknown
AA seq 1336 aa
MMASVPNSDELIFFVNGRKVIEKNADPEVNLLYYLRKVLYLTGTKYSCGGGGCGACTVMV
SRYDPKTKKIHHSPVTACLVPICSLYGAAVTTVEGVGSIRTRIHPVQERLAKCHGTQCGF
CSPGMVMSIYTLLRNHPEPTLEQITKALGGNLCRCTGYRPIVESGKTFCAESTICGLKGS
GKCCMDQEERSFVNRQEKMCTKLYNEDEFQPLDPSQEPIFPPELIRMAEDPNKRRLMFQG
ERTTWITPVTLSDLLELKTNFPEAPLIMGNTAVGPSIKFRGEFHPVFIFPLGLPELYFVD
YTDDGVTIGAGYSLAQLNDALHLTVLEQPKEKTKTYRALLKHLRTLAGAQIRNMATLGGH
VVSRPNFSDLNPILAAGNATINLISKGGERQIPLNSHFLERSPEASLKSEEIVLSVHIPH
STQWHFVSGLRLAQRQENAFAIVNAGMSVKFEDGTDTIKDLQMFYGSVGPTVVSASQTCK
QLIGRSWDDHMLSDACRWVLDEIYIPPAAEGGMVEYRRTLIISLLFKFYLKVRRRLNKMD
PHKFPDIPERYMSALEDFPIKTPQGIQMFQCVDPYQSPQDPIGHPVMHQSAIKHATGEAV
FSDDMPPIAQELFLAVTTSTRAHAKIISIDASEALALPGVFDVITAEDVPGDNNHQGEVL
YAQNEVICMGQIVCTVAADTYAHAREAAKKVKITYEDIQPRIITIEQALEHNSFFSIEKK
VEQGNVEQAFKYVDQIIEGEAHVEGQEHFYMETQTILAIPKQEDKEMVLYLGTQFPSHAQ
EFVAAALNIPRSRIACHVKRIGGGFGGKVTKPALLGAIGAVAANKTGRPIRFILERGDDM
LITAGRHPLLGKYKIGFMNNGVIKAADVEYYINGGCTPDESESVTEFIVLKSDNAYYIPN
FRCRGRPCKTNLPSNTAFRGYGFPEAAVVAEAYMAAVASQCNLSPEEVKEINMYKRISTT
AYKQTFNPEPLRRCWKECLEKSSFSARKLAAEEFNKKNYWKKRGLAVVPMKFTVGFPVAY
YNQAAALVHIYLDGSVLVTHGGCEMGQGLHTKMIQVASRELNIPQSYIHLSETSTITVPN
ASFTAASMGADINGKAVQNACQILMARLQPIIRKNPEGRWEDWIAKAFEESISLSTTGYF
KGYQTYMDWEKEKGDPYPYYVYGASCSEVEVDCLTGAHKLLRTDIFMDAAFSINPALDIG
QIEGAFIQGMGFYTIEELKYSPEGVLYSRSPDDYKIPTVTEIPEEFYVTLVRSQNPTAIY
SSKGLGEAGMFLGSSVLFAIFDAVTAARKERGLTKTFTLNSPATPEFIRMTCMDQFTDMI
PRDDPSTFTPWSIHVS
NT seq 4011 nt   +upstreamnt  +downstreamnt
atgatggcttctgttcccaattctgatgaactgattttttttgtgaatggaagaaaggtc
atagagaagaatgctgatcctgaagtaaacctactatactacctgaggaaagtcctctat
ctcacaggcaccaagtacagctgtgggggaggaggctgtggcgcctgcactgtcatggtg
tcaagatacgaccccaagaccaagaagatccaccactctccagttacagcgtgcttggtg
cccatctgctctctgtatggggctgctgtcacaacagtggaaggtgtaggaagcattcgc
accaggattcatcccgtacaggagagacttgccaagtgtcatggcacacagtgtggcttc
tgcagtccaggaatggtgatgtccatctacacactgttgaggaaccacccagagccaacc
ctggagcagataaccaaagctcttggaggtaacttgtgccgctgtactggataccgacca
attgtagaaagtggaaaaactttctgtgcggaatcaactatttgtggactgaaaggatca
ggaaaatgttgcatggatcaagaagagaggtcttttgtaaatagacaggaaaaaatgtgt
accaaactgtataatgaagatgaattccagcccttggatccatcccaggaacctatattc
cctcctgaactaataagaatggcagaagatccaaacaagagaaggctgatgttccaaggg
gagaggactacctggatcacccctgtgaccctcagtgatcttctggagctgaaaaccaat
ttccctgaagcccccctcatcatggggaacactgcagtgggacctagcattaaattcaga
ggtgaattccatccagttttcatatttccacttgggcttccagaactatattttgtggac
tacacagatgatggagtgacaataggggcagggtacagcctggcccagctgaatgacgct
ttacatcttactgttttggagcaaccaaaggagaagactaagacttaccgtgctctcctg
aagcatctgaggacacttgctggagcccagataaggaatatggcgactttaggaggacat
gtggtgagcagacctaatttttctgacctgaatcccattttagcagcaggaaatgctacc
atcaatctgatatccaaaggaggagaacggcagattcctttaaacagccattttcttgag
agatcacctgaagccagcctcaaatcagaagagattgtgttatctgttcatattccccac
tctactcagtggcactttgtgtcaggactcaggctggcccaacgtcaggaaaatgctttt
gccattgtcaatgccggcatgagtgtgaagtttgaagatggtacagacacgattaaggat
cttcaaatgttctatggaagtgttggccccactgttgtctctgcaagccaaacgtgcaag
cagctcattgggaggtcgtgggatgaccacatgctgagtgatgcctgccgttgggtcctg
gatgagatttacattccaccagcagctgagggtggcatggtagagtacaggcgaaccctc
atcatcagcttactcttcaaattctacctcaaagtgaggcgaagactgaataaaatggat
ccccataagtttcctgatatcccagaaaggtacatgagtgccttagaagatttccccata
aaaacaccgcaaggaattcagatgtttcagtgtgtggatccctaccaatccccacaagac
cccatcggccacccagtcatgcaccagtcagccatcaaacatgccacaggggaggctgta
tttagtgatgacatgccccctattgcccaagaactcttcctggctgtaaccaccagcacc
agagctcacgcaaagatcatatcaattgatgcttcagaagccctggcccttccaggtgtt
tttgatgtgataacagcagaggacgttccaggagataataaccatcagggagaggtcctc
tatgcacagaatgaggttatttgcatgggtcagattgtctgcactgtggctgctgacacc
tatgctcatgcaagagaggcggctaaaaaagtgaagatcacttatgaagacatacaacca
aggattatcacaatagagcaagcactagagcacaattcatttttttccattgaaaagaaa
gtcgagcaaggaaatgtagagcaagcctttaaatatgttgatcaaatcattgaaggtgag
gcccatgtagaagggcaggaacatttctacatggaaacgcaaactatcctggctatccca
aaacaggaagataaagaaatggtcctataccttggaacacagtttccaagccatgcgcag
gaatttgtggctgcagcattaaacattccaaggagtaggatcgcctgccacgtgaaaaga
attggaggaggatttgggggaaaagtgaccaagcctgctctgctaggagccattggtgcc
gtggccgccaacaagactggccgcccaatccggtttattctagagcgtggtgatgacatg
ctgataactgctggccgccacccactcctcggaaaatacaaaattggattcatgaacaac
ggtgtgatcaaagctgctgatgttgaatattatatcaacggtggatgcactcctgatgag
tctgagtcggtaacagagttcatcgtgctgaaatctgacaatgcatattatattcctaat
ttccggtgccggggtaggccctgcaaaacaaatttgccatccaacacagccttccgagga
tatggcttccctgaggctgcagtggtggcagaagcttacatggctgctgtggcatcgcaa
tgtaacttatcccctgaagaggttaaagaaataaacatgtataagagaattagcacaaca
gcctacaagcagacatttaatccagagccattgcgaagatgctggaaagaatgtctggag
aaatcttcattctctgctaggaaactggctgcagaggaatttaacaaaaagaactactgg
aagaagagggggcttgccgtggtccccatgaaatttaccgttgggttccctgtggcctac
tacaatcaggcagctgctctagtccatatctaccttgatggctccgtcctggtgactcat
ggtggctgtgaaatgggacaaggtcttcacaccaaaatgattcaggtggctagtcgagaa
ctgaacatcccccagtcatatatacacctgtctgaaacaagcaccatcacagtgcccaat
gctagcttcacggcggcgtcgatgggagcagacatcaacgggaaggctgtacagaatgcc
tgccaaattcttatggcccgtcttcagccaatcatcaggaaaaaccctgaaggaagatgg
gaggactggattgcaaaagcctttgaagaatccatcagtctctcaactactggatatttc
aaaggctaccagacgtatatggactgggagaaggagaaaggtgacccctatccatattat
gtttatggagcatcctgttctgaggttgaagttgactgtctgactggggctcataagctc
cttagaactgacatcttcatggatgctgctttcagcataaacccagccctggacattgga
cagattgaaggagcatttatccaaggcatgggattctataccatagaggaactgaaatat
tccccagaaggtgttctctactctagaagtccagatgactacaaaatcccaactgtcact
gagataccagaagagttctatgtcactttggtgcgttcccaaaatcccacagccatctat
tcctccaaggggttgggtgaggctggaatgttcttgggatcctccgtgttgttcgccata
tttgatgcagtgactgctgcccgcaaagagagggggctgaccaagaccttcaccctgaat
agcccagcaactcctgagtttattaggatgacttgtatggatcagtttactgacatgatt
cctagagatgatccttcaacatttacaccttggtccatccatgtgtcttaa

DBGET integrated database retrieval system