KEGG   Ursus arctos horribilis: 113250626Help
Entry
113250626         CDS       T05909                                 

Gene name
HSPD1
Definition
(RefSeq) 60 kDa heat shock protein, mitochondrial
  KO
K04077  chaperonin GroEL
Organism
uah  Ursus arctos horribilis
Pathway
uah03018  RNA degradation
uah04940  Type I diabetes mellitus
uah05134  Legionellosis
uah05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    113250626 (HSPD1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113250626 (HSPD1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    113250626 (HSPD1)
   05152 Tuberculosis
    113250626 (HSPD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:uah03019]
    113250626 (HSPD1)
   03110 Chaperones and folding catalysts [BR:uah03110]
    113250626 (HSPD1)
   03029 Mitochondrial biogenesis [BR:uah03029]
    113250626 (HSPD1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113250626 (HSPD1)
Messenger RNA biogenesis [BR:uah03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     113250626 (HSPD1)
Chaperones and folding catalysts [BR:uah03110]
 Heat shock proteins
  HSP60 / Chaperonin
   113250626 (HSPD1)
Mitochondrial biogenesis [BR:uah03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    113250626 (HSPD1)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113250626 (HSPD1)
  Exosomal proteins of other body fluids (saliva and urine)
   113250626 (HSPD1)
  Exosomal proteins of breast cancer cells
   113250626 (HSPD1)
  Exosomal proteins of colorectal cancer cells
   113250626 (HSPD1)
  Exosomal proteins of bladder cancer cells
   113250626 (HSPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-GeneID: 113250626
NCBI-ProteinID: XP_026348040
UniProt: A0A3Q7V7F0
LinkDB All DBs
Position
Unknown
AA seq 573 aa AA seqDB search
MLRLPAVLRQIRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDITTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKIMQSSSEIGYDAMLGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGGMGGMGGGMGGGMF
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgattacccgcagtccttcgccaaattaggccagtgtccagagcactggctcct
catctcactcgggcctatgccaaagatgtaaaatttggtgcagatgcccgagccttaatg
cttcaaggtgtagaccttttagccgatgctgtagccgttactatggggccaaagggaaga
acagtgattattgaacagagttggggaagtcccaaagtaacaaaagatggtgtgaccgta
gcaaagtcaattgacttaaaagataaatataaaaatattggcgctaaacttgttcaagat
gttgccaataacacgaatgaagaggctggggatggcaccacaactgctactgtcctggca
cgctctattgccaaggaaggctttgagaagattagcaaaggtgctaatcctgtggaaatc
agaagaggtgtgatgttagctgttgatgctgtaattgctgaacttaagaagcagtctaaa
cccgtgacaacccctgaagaaattgctcaggttgctacgatttctgcaaatggagacaaa
gaaattggcaacatcatttccgatgcaatgaaaaaggttggaagaaagggtgtcatcaca
gtgaaggatggaaaaacactaaatgatgaattagaaattattgaaggcatgaagtttgat
cgaggttatatttctccatattttattaatacatcaaaaggtcagaaatgtgaattccaa
gatgcctatgttctgttgagtgaaaagaaaatttctagtgtccagtccattgtacctgct
cttgaaattgccaatgctcaccgtaagcccttggtcataattgccgaagatgttgatgga
gaagctctgagtacacttgttttgaataggctaaaagttggtcttcaggttgtggcagtc
aaagctccaggttttggtgacaatagaaagaaccagcttaaagacatggctattgctact
ggtggtgcagtatttggggaagaaggattgactctaaatctcgaagatgttcagcctcac
gacttaggaaaagttggagaggtcattgtgaccaaagatgatgccatgctcttaaaggga
aaaggtgacaaggctcaaattgaaaaacgtattcaagaaatcattgagcagttagatatc
acaactagtgaatatgagaaggaaaagctgaatgaacgtctggcaaaactctcagatgga
gtagctgtgttgaaggttggtgggacaagtgatgttgaagtgaatgaaaagaaagacaga
gttacagatgccctcaatgcgacacgagctgctgttgaagaaggcattgttctgggaggg
ggttgtgccctgcttcggtgcattccagccttggattcactaactccagctaatgaagat
caaaaaattggtatagaaattattaagagaacactcaaaatccctgcaatgaccattgct
aagaatgcaggtgttgaaggatcgttgatagttgagaaaattatgcagagttcctcagaa
attggttatgatgctatgcttggagattttgtgaatatggtggaaaaaggaatcattgat
ccaactaaggttgtaagaactgctttattggatgctgctggagtggcctctctgttaact
acagcagaagttgtagtcaccgaaattcctaaagaagagaaggacccaggaatgggcgga
atgggtggaatgggaggtggtatgggaggtggcatgttctga

DBGET integrated database retrieval system