KEGG   Ursus arctos horribilis: 113250651
Entry
113250651         CDS       T05909                                 

Gene name
STAT4
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
uah  Ursus arctos horribilis
Pathway
uah04217  Necroptosis
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah05161  Hepatitis B
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113250651 (STAT4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113250651 (STAT4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113250651 (STAT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113250651 (STAT4)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113250651 (STAT4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    113250651 (STAT4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113250651 (STAT4)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    113250651 (STAT4)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 NPV_P10
Other DBs
NCBI-GeneID: 113250651
NCBI-ProteinID: XP_026348085
UniProt: A0A3Q7V7J5
LinkDB
Position
Unknown
AA seq 748 aa
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILFQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQGDKNHALMNQEVLTLQEMLNSLDFKRKEALSKMTQIVNETDLLMNSMLMEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRAHL
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTHVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH
MVTEELHSITFESQICLYGLTIDLETSSLPVVMISNVSQLPNAWASVIWYNVSTNDSQNL
VFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNMLAEKLTVQSSYNDGHLTWAKFCK
EHLPGKAFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYSAE
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgtctcagtggaatcaagttcaacaattagaaatcaaatttttggagcaagtggatcaa
ttctacgatgacaactttcctatggagattcgacatctgttggctcagtggattgaaaat
caagactgggaggcggcttccaacaatgaaaccatggcaacaattctttttcaaaatttg
ttaatacaactggatgaacaattaggtcgtgtttccaaagagaaaaatctgctcttgata
cacaatctaaaaagaattaggaaagtccttcagggaaaatttcatggaaacccaatgcac
gtagctgtggttatttcaaattgtttaagggaggagaggagaatattggctgcagccaac
atgcccgttcaggggcctctggagaagtccttacaaagttcttcagtttcagaaaggcag
aggaatgtggagcacaaagtggctgccattaaaaacagcgtgcagatgacagaacaagac
accaaatatttagaagacctgcaagatgaatttgactacaggtataaaacaattcagaca
atggatcagggggacaagaaccacgccctaatgaatcaggaagttttgactctgcaagaa
atgcttaacagtcttgacttcaagagaaaggaagccctcagtaagatgacacaaattgta
aatgaaacggacttgttaatgaacagcatgctgatggaagagctgcaggactggaagagg
aggcagcagattgcctgcatcggggggccgctccacaatggtctcgaccagctgcaaaac
tgctttacactattggcagaaagtctgttccaactcagaaggcaattggagaaattagag
gaacagtctactaaaatgacatatgaaggggaccccatccccatgcaaagagcacatctg
ctagaaagagtcaccttcttgatctacaacctttttaagaactcatttgtggttgaacga
cagccatgcatgccaacccacccccagagaccgatggtacttaaaactcttatccagttc
actgtaaagctaagactactaataaaattgccagaactaaactatcaagtaaaggtgaaa
gcatcaattgacaagaatgtttcaactctaagcaatcgaagatttgtcctttgcggaact
cacgtcaaagccatgtccattgaagaatcttctaatggaagtctctcggtagaatttcga
catttgcaaccaaaggaaatgaagtccagcgctggaggcaaaggaaatgagggctgtcac
atggtgactgaagagcttcattctataacctttgaatcacagatctgcctctatggcctg
accatagatttggagaccagctcattacctgtggtgatgatttccaatgtcagtcagtta
cctaatgcttgggcatccgtcatttggtacaatgtgtcaaccaatgattcccagaacctg
gttttctttaataatcctccatctgccactttgagtcaactcctggaagtgatgagctgg
cagttttcatcctacgttggccgtggccttaactcagatcaactcaatatgttagcagag
aagcttacagtccaatctagctacaatgatggtcatctcacctgggccaagttctgcaag
gaacacttacctggtaaagcatttaccttttggacatggcttgaagcaatattagatcta
attaagaaacacattcttcctctttggatagatgggtatgtcatgggctttgttagcaaa
gagaaggagcgcctcttgctaaaggataaaatgcctggaacctttttgttaagattcagt
gaaagccaccttggaggaataactttcacctgggtagaccattctgaaaatggagaagtg
agattccactctgtagaaccctacaataagggccggttgtctgctctgccattcgccgac
atccttcgagattacaaggttattatggctgaaaacattcctgaaaaccctctgaagtac
ctttatcctgacattcccaaagacaaagccttcggtaaacactacagctcccagccatgc
gaagtttcaagaccaacagaaaggggggacaaaggttatgttccatctgtttttataccc
atttcaacaatccgaagtgattcaactgagccacattctccatcagatcttcttcccatg
tctccaagcgtatatgcagtgctgagagaaaacctgagtcccacaacaattgaaacggca
atgaagtctccgtattctgctgaatga

DBGET integrated database retrieval system